BLASTX nr result
ID: Astragalus22_contig00008366
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00008366 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX86238.1| hypothetical protein L195_g042315 [Trifolium prat... 55 1e-06 dbj|GAU43379.1| hypothetical protein TSUD_254620 [Trifolium subt... 57 1e-06 ref|XP_004491644.1| PREDICTED: epidermal growth factor receptor ... 56 2e-06 ref|XP_004491645.1| PREDICTED: epidermal growth factor receptor ... 54 8e-06 >gb|PNX86238.1| hypothetical protein L195_g042315 [Trifolium pratense] Length = 161 Score = 55.1 bits (131), Expect = 1e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +2 Query: 305 EFALVKEYTLDVQNIIAPPKQKLPAAVNT 391 EFALVKEYTLDV+N IAPPKQKLP AVNT Sbjct: 17 EFALVKEYTLDVKNTIAPPKQKLPKAVNT 45 >dbj|GAU43379.1| hypothetical protein TSUD_254620 [Trifolium subterraneum] Length = 1051 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +2 Query: 305 EFALVKEYTLDVQNIIAPPKQKLPAAVNT 391 EFALVKEYTLDVQN IAPPKQKLP AVNT Sbjct: 726 EFALVKEYTLDVQNTIAPPKQKLPKAVNT 754 >ref|XP_004491644.1| PREDICTED: epidermal growth factor receptor substrate 15-like 1 isoform X1 [Cicer arietinum] Length = 1018 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 302 AEFALVKEYTLDVQNIIAPPKQKLPAAVNT 391 AEFALVKEYTLDVQN IAPPKQKLP AV T Sbjct: 700 AEFALVKEYTLDVQNTIAPPKQKLPKAVKT 729 >ref|XP_004491645.1| PREDICTED: epidermal growth factor receptor substrate 15-like 1 isoform X2 [Cicer arietinum] Length = 1017 Score = 54.3 bits (129), Expect = 8e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +2 Query: 305 EFALVKEYTLDVQNIIAPPKQKLPAAVNT 391 EFALVKEYTLDVQN IAPPKQKLP AV T Sbjct: 700 EFALVKEYTLDVQNTIAPPKQKLPKAVKT 728