BLASTX nr result
ID: Astragalus22_contig00008290
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00008290 (325 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX84642.1| hypothetical protein L195_g040705 [Trifolium prat... 68 3e-12 ref|XP_013461798.1| hypothetical protein MTR_3g103290 [Medicago ... 67 1e-11 dbj|GAU31162.1| hypothetical protein TSUD_315870 [Trifolium subt... 61 3e-09 ref|NP_001239737.1| uncharacterized protein LOC100801557 [Glycin... 60 8e-09 gb|KHN04430.1| hypothetical protein glysoja_019517 [Glycine soja] 57 6e-08 ref|XP_003524022.1| PREDICTED: uncharacterized protein LOC100785... 57 6e-08 ref|XP_014500245.1| uncharacterized protein LOC106761232 [Vigna ... 57 1e-07 ref|XP_015935124.1| uncharacterized protein LOC107461171 [Arachi... 56 3e-07 ref|XP_016165771.1| uncharacterized protein LOC107608515 [Arachi... 56 3e-07 ref|XP_017421139.1| PREDICTED: uncharacterized protein LOC108331... 55 3e-07 ref|XP_020211504.1| uncharacterized protein LOC109796232 [Cajanu... 55 5e-07 >gb|PNX84642.1| hypothetical protein L195_g040705 [Trifolium pratense] Length = 121 Score = 67.8 bits (164), Expect = 3e-12 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = -1 Query: 325 KSVSVGMGRIDEEKE-DVGEANVSVVTNSYPRSRSYAVGKTS 203 KSVSVGMGRIDEEK D+GE +V VVTNSYPRSRSYAVGKT+ Sbjct: 77 KSVSVGMGRIDEEKAGDLGEGDVPVVTNSYPRSRSYAVGKTN 118 >ref|XP_013461798.1| hypothetical protein MTR_3g103290 [Medicago truncatula] gb|KEH35833.1| hypothetical protein MTR_3g103290 [Medicago truncatula] Length = 158 Score = 67.0 bits (162), Expect = 1e-11 Identities = 34/47 (72%), Positives = 39/47 (82%), Gaps = 3/47 (6%) Frame = -1 Query: 325 KSVSVGMGRIDEEK---EDVGEANVSVVTNSYPRSRSYAVGKTSVIM 194 KSVSVGMGRIDEEK +D+ E +V VV NSYPRSRSYAVGK SV++ Sbjct: 112 KSVSVGMGRIDEEKPSDDDIAEGDVPVVANSYPRSRSYAVGKRSVVL 158 >dbj|GAU31162.1| hypothetical protein TSUD_315870 [Trifolium subterraneum] Length = 162 Score = 60.8 bits (146), Expect = 3e-09 Identities = 31/45 (68%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = -1 Query: 325 KSVSVGMGRIDEEK-EDVGEANVSVVTNSYPRSRSYAVGKTSVIM 194 KSVSVGMGRI+EEK D+GE +V VTN YPRSRS+AVGK +V++ Sbjct: 118 KSVSVGMGRIEEEKASDLGEGDVPDVTNFYPRSRSHAVGKRNVVL 162 >ref|NP_001239737.1| uncharacterized protein LOC100801557 [Glycine max] ref|XP_014631650.1| PREDICTED: uncharacterized protein LOC100801557 isoform X1 [Glycine max] gb|ACU19023.1| unknown [Glycine max] gb|KHN45134.1| hypothetical protein glysoja_031362 [Glycine soja] gb|KRH52122.1| hypothetical protein GLYMA_06G047600 [Glycine max] Length = 156 Score = 59.7 bits (143), Expect = 8e-09 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 325 KSVSVGMGRIDEEKE-DVGEANVSVVTNSYPRSRSYAVGKTSVIM 194 KS SVGMGRIDE+ D+GE V VV +YPRSRSYAVGKTS ++ Sbjct: 112 KSTSVGMGRIDEDTPYDLGEGEVPVVPKAYPRSRSYAVGKTSAVL 156 >gb|KHN04430.1| hypothetical protein glysoja_019517 [Glycine soja] Length = 155 Score = 57.4 bits (137), Expect = 6e-08 Identities = 29/45 (64%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 325 KSVSVGMGRIDEEKE-DVGEANVSVVTNSYPRSRSYAVGKTSVIM 194 KS SVGMGRIDE+ D+GE V VV +YPRSRSYAVG TS ++ Sbjct: 111 KSTSVGMGRIDEDTPYDLGEGEVPVVPKAYPRSRSYAVGMTSAVL 155 >ref|XP_003524022.1| PREDICTED: uncharacterized protein LOC100785988 [Glycine max] gb|KRH61435.1| hypothetical protein GLYMA_04G046800 [Glycine max] Length = 155 Score = 57.4 bits (137), Expect = 6e-08 Identities = 29/45 (64%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 325 KSVSVGMGRIDEEKE-DVGEANVSVVTNSYPRSRSYAVGKTSVIM 194 KS SVGMGRIDE+ D+GE V VV +YPRSRSYAVG TS ++ Sbjct: 111 KSTSVGMGRIDEDTPYDLGEGEVPVVPKAYPRSRSYAVGMTSAVL 155 >ref|XP_014500245.1| uncharacterized protein LOC106761232 [Vigna radiata var. radiata] Length = 155 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/45 (62%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 325 KSVSVGMGRIDEEKE-DVGEANVSVVTNSYPRSRSYAVGKTSVIM 194 KS SVGMGRIDE+ D+ E +V + SYPRSRSYAVGKTS ++ Sbjct: 111 KSTSVGMGRIDEDTPYDLSEGDVGTLPKSYPRSRSYAVGKTSAVL 155 >ref|XP_015935124.1| uncharacterized protein LOC107461171 [Arachis duranensis] Length = 164 Score = 55.8 bits (133), Expect = 3e-07 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -1 Query: 325 KSVSVGMGRIDEEKE-DVGEANVSVVTNSYPRSRSYAVG 212 KSVSVGMGRIDE+K D+ E +VV NSYPRSRSYAVG Sbjct: 118 KSVSVGMGRIDEDKPFDLNEGGEAVVPNSYPRSRSYAVG 156 >ref|XP_016165771.1| uncharacterized protein LOC107608515 [Arachis ipaensis] Length = 170 Score = 55.8 bits (133), Expect = 3e-07 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -1 Query: 325 KSVSVGMGRIDEEKE-DVGEANVSVVTNSYPRSRSYAVG 212 KSVSVGMGRIDE+K D+ E +VV NSYPRSRSYAVG Sbjct: 118 KSVSVGMGRIDEDKPFDLNEGGEAVVPNSYPRSRSYAVG 156 >ref|XP_017421139.1| PREDICTED: uncharacterized protein LOC108331039 [Vigna angularis] gb|KOM42212.1| hypothetical protein LR48_Vigan04g241000 [Vigna angularis] dbj|BAT77928.1| hypothetical protein VIGAN_02054300 [Vigna angularis var. angularis] Length = 155 Score = 55.5 bits (132), Expect = 3e-07 Identities = 27/45 (60%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 325 KSVSVGMGRIDEEKE-DVGEANVSVVTNSYPRSRSYAVGKTSVIM 194 KS SVGMGRIDE+ D+ E +V + +YPRSRSYAVGKTS ++ Sbjct: 111 KSTSVGMGRIDEDTPYDLSEGDVGTLPKAYPRSRSYAVGKTSAVL 155 >ref|XP_020211504.1| uncharacterized protein LOC109796232 [Cajanus cajan] gb|KYP70385.1| hypothetical protein KK1_009601 [Cajanus cajan] Length = 163 Score = 55.1 bits (131), Expect = 5e-07 Identities = 26/45 (57%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 325 KSVSVGMGRIDEEKE-DVGEANVSVVTNSYPRSRSYAVGKTSVIM 194 KS SVGMGRIDE+ D+G+ + + +YPRSRSYAVGKTS ++ Sbjct: 118 KSTSVGMGRIDEDSPFDLGQGELPALPKAYPRSRSYAVGKTSAVL 162