BLASTX nr result
ID: Astragalus22_contig00008268
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00008268 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020217909.1| protein RER1B-like [Cajanus cajan] >gi|10123... 83 2e-17 gb|AFK41613.1| unknown [Lotus japonicus] 83 3e-17 ref|XP_007131820.1| hypothetical protein PHAVU_011G044200g [Phas... 83 3e-17 ref|XP_016186985.1| protein RER1A [Arachis ipaensis] 83 3e-17 ref|XP_015951999.1| protein RER1A [Arachis duranensis] 83 3e-17 ref|XP_015570720.1| PREDICTED: protein RER1A, partial [Ricinus c... 82 4e-17 ref|XP_008460950.1| PREDICTED: protein RER1A isoform X2 [Cucumis... 82 4e-17 ref|XP_008460948.1| PREDICTED: protein RER1A isoform X1 [Cucumis... 82 4e-17 ref|XP_023513319.1| protein RER1A-like [Cucurbita pepo subsp. pepo] 82 4e-17 ref|XP_023533159.1| protein RER1A-like [Cucurbita pepo subsp. pepo] 82 4e-17 ref|XP_023007341.1| protein RER1A-like [Cucurbita maxima] 82 4e-17 ref|XP_022947776.1| protein RER1A-like [Cucurbita moschata] 82 4e-17 ref|XP_022943556.1| protein RER1A-like [Cucurbita moschata] 82 4e-17 ref|XP_022146273.1| protein RER1A-like [Momordica charantia] 82 4e-17 ref|XP_004148836.1| PREDICTED: protein RER1A [Cucumis sativus] >... 82 4e-17 gb|EEF49424.1| rer1 protein, putative [Ricinus communis] 82 5e-17 ref|XP_014494578.1| protein RER1B [Vigna radiata var. radiata] >... 82 6e-17 ref|XP_017431430.1| PREDICTED: protein RER1B-like [Vigna angular... 82 6e-17 ref|XP_004507459.1| PREDICTED: protein RER1A-like [Cicer arietinum] 82 6e-17 ref|XP_021656042.1| protein RER1B-like isoform X2 [Hevea brasili... 82 7e-17 >ref|XP_020217909.1| protein RER1B-like [Cajanus cajan] gb|KYP66092.1| Protein RER1B [Cajanus cajan] Length = 194 Score = 83.2 bits (204), Expect = 2e-17 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFSVFD PVFW IL CYWVVLF+ Sbjct: 110 RLPEFKFWYSFTKAFCIAFVMTFFSVFDVPVFWPILLCYWVVLFV 154 >gb|AFK41613.1| unknown [Lotus japonicus] Length = 194 Score = 82.8 bits (203), Expect = 3e-17 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFSVFD PVFW IL CYW+VLF+ Sbjct: 110 RLPEFKFWYSFTKAFCIAFVMTFFSVFDVPVFWPILLCYWIVLFV 154 >ref|XP_007131820.1| hypothetical protein PHAVU_011G044200g [Phaseolus vulgaris] ref|XP_007131821.1| hypothetical protein PHAVU_011G044200g [Phaseolus vulgaris] gb|ESW03814.1| hypothetical protein PHAVU_011G044200g [Phaseolus vulgaris] gb|ESW03815.1| hypothetical protein PHAVU_011G044200g [Phaseolus vulgaris] Length = 194 Score = 82.8 bits (203), Expect = 3e-17 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFC+AFVMTFFSVFD PVFW IL CYWVVLF+ Sbjct: 110 RLPEFKFWYSFTKAFCVAFVMTFFSVFDVPVFWPILLCYWVVLFV 154 >ref|XP_016186985.1| protein RER1A [Arachis ipaensis] Length = 196 Score = 82.8 bits (203), Expect = 3e-17 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFSVFD PVFW IL CYW+VLF+ Sbjct: 112 RLPEFKFWYSFTKAFCIAFVMTFFSVFDVPVFWPILLCYWIVLFV 156 >ref|XP_015951999.1| protein RER1A [Arachis duranensis] Length = 196 Score = 82.8 bits (203), Expect = 3e-17 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFSVFD PVFW IL CYW+VLF+ Sbjct: 112 RLPEFKFWYSFTKAFCIAFVMTFFSVFDVPVFWPILLCYWIVLFV 156 >ref|XP_015570720.1| PREDICTED: protein RER1A, partial [Ricinus communis] Length = 156 Score = 81.6 bits (200), Expect = 4e-17 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFS+FD PVFW IL CYW+VLF+ Sbjct: 72 RLPEFKFWYSFTKAFCIAFVMTFFSMFDVPVFWPILLCYWIVLFV 116 >ref|XP_008460950.1| PREDICTED: protein RER1A isoform X2 [Cucumis melo] Length = 192 Score = 82.4 bits (202), Expect = 4e-17 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFS+FD PVFW IL CYW+VLF+ Sbjct: 110 RLPEFKFWYSFTKAFCIAFVMTFFSIFDVPVFWPILLCYWIVLFV 154 >ref|XP_008460948.1| PREDICTED: protein RER1A isoform X1 [Cucumis melo] ref|XP_008460949.1| PREDICTED: protein RER1A isoform X1 [Cucumis melo] Length = 193 Score = 82.4 bits (202), Expect = 4e-17 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFS+FD PVFW IL CYW+VLF+ Sbjct: 110 RLPEFKFWYSFTKAFCIAFVMTFFSIFDVPVFWPILLCYWIVLFV 154 >ref|XP_023513319.1| protein RER1A-like [Cucurbita pepo subsp. pepo] Length = 194 Score = 82.4 bits (202), Expect = 4e-17 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFS+FD PVFW IL CYW+VLF+ Sbjct: 110 RLPEFKFWYSFTKAFCIAFVMTFFSIFDVPVFWPILLCYWIVLFV 154 >ref|XP_023533159.1| protein RER1A-like [Cucurbita pepo subsp. pepo] Length = 194 Score = 82.4 bits (202), Expect = 4e-17 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFS+FD PVFW IL CYW+VLF+ Sbjct: 110 RLPEFKFWYSFTKAFCIAFVMTFFSIFDVPVFWPILLCYWIVLFV 154 >ref|XP_023007341.1| protein RER1A-like [Cucurbita maxima] Length = 194 Score = 82.4 bits (202), Expect = 4e-17 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFS+FD PVFW IL CYW+VLF+ Sbjct: 110 RLPEFKFWYSFTKAFCIAFVMTFFSIFDVPVFWPILLCYWIVLFV 154 >ref|XP_022947776.1| protein RER1A-like [Cucurbita moschata] Length = 194 Score = 82.4 bits (202), Expect = 4e-17 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFS+FD PVFW IL CYW+VLF+ Sbjct: 110 RLPEFKFWYSFTKAFCIAFVMTFFSIFDVPVFWPILLCYWIVLFV 154 >ref|XP_022943556.1| protein RER1A-like [Cucurbita moschata] Length = 194 Score = 82.4 bits (202), Expect = 4e-17 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFS+FD PVFW IL CYW+VLF+ Sbjct: 110 RLPEFKFWYSFTKAFCIAFVMTFFSIFDVPVFWPILLCYWIVLFV 154 >ref|XP_022146273.1| protein RER1A-like [Momordica charantia] Length = 194 Score = 82.4 bits (202), Expect = 4e-17 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFS+FD PVFW IL CYW+VLF+ Sbjct: 110 RLPEFKFWYSFTKAFCIAFVMTFFSIFDVPVFWPILLCYWIVLFV 154 >ref|XP_004148836.1| PREDICTED: protein RER1A [Cucumis sativus] gb|KGN61806.1| hypothetical protein Csa_2G248640 [Cucumis sativus] Length = 194 Score = 82.4 bits (202), Expect = 4e-17 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFS+FD PVFW IL CYW+VLF+ Sbjct: 110 RLPEFKFWYSFTKAFCIAFVMTFFSIFDVPVFWPILLCYWIVLFV 154 >gb|EEF49424.1| rer1 protein, putative [Ricinus communis] Length = 168 Score = 81.6 bits (200), Expect = 5e-17 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFS+FD PVFW IL CYW+VLF+ Sbjct: 84 RLPEFKFWYSFTKAFCIAFVMTFFSMFDVPVFWPILLCYWIVLFV 128 >ref|XP_014494578.1| protein RER1B [Vigna radiata var. radiata] ref|XP_014494579.1| protein RER1B [Vigna radiata var. radiata] ref|XP_014494581.1| protein RER1B [Vigna radiata var. radiata] Length = 194 Score = 82.0 bits (201), Expect = 6e-17 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAF+MTFFSVFD PVFW IL CYWVVLF+ Sbjct: 110 RLPEFKFWYSFTKAFCIAFMMTFFSVFDVPVFWPILLCYWVVLFV 154 >ref|XP_017431430.1| PREDICTED: protein RER1B-like [Vigna angularis] ref|XP_017431431.1| PREDICTED: protein RER1B-like [Vigna angularis] gb|KOM50907.1| hypothetical protein LR48_Vigan08g173400 [Vigna angularis] dbj|BAT90936.1| hypothetical protein VIGAN_06223300 [Vigna angularis var. angularis] Length = 194 Score = 82.0 bits (201), Expect = 6e-17 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAF+MTFFSVFD PVFW IL CYWVVLF+ Sbjct: 110 RLPEFKFWYSFTKAFCIAFMMTFFSVFDVPVFWPILLCYWVVLFV 154 >ref|XP_004507459.1| PREDICTED: protein RER1A-like [Cicer arietinum] Length = 196 Score = 82.0 bits (201), Expect = 6e-17 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAF+MTFFSVFD PVFW IL CYWVVLF+ Sbjct: 112 RLPEFKFWYSFTKAFCIAFLMTFFSVFDVPVFWPILLCYWVVLFV 156 >ref|XP_021656042.1| protein RER1B-like isoform X2 [Hevea brasiliensis] Length = 184 Score = 81.6 bits (200), Expect = 7e-17 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 QLPELKFRYSFTNAFCIAFVMTFFSVFDAPVFWSILPCYWVVLFL 137 +LPE KF YSFT AFCIAFVMTFFS+FD PVFW IL CYW+VLF+ Sbjct: 110 RLPEFKFWYSFTKAFCIAFVMTFFSMFDVPVFWPILLCYWIVLFV 154