BLASTX nr result
ID: Astragalus22_contig00008196
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00008196 (936 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN17264.1| Cytokinin dehydrogenase 7 [Glycine soja] 74 3e-11 gb|KHN37061.1| Cytokinin dehydrogenase 7 [Glycine soja] 74 3e-11 ref|XP_014625277.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin de... 74 8e-11 ref|XP_003544550.1| PREDICTED: cytokinin dehydrogenase 7-like [G... 74 8e-11 gb|PNY11662.1| cytokinin dehydrogenase 7-like protein [Trifolium... 73 9e-11 dbj|GAU17639.1| hypothetical protein TSUD_07000 [Trifolium subte... 73 9e-11 ref|XP_003588931.1| cytokinin oxidase/dehydrogenase-like protein... 73 1e-10 ref|XP_004498857.1| PREDICTED: cytokinin dehydrogenase 7 [Cicer ... 73 2e-10 gb|ALS05393.1| cytokinin oxidase/dehydrogenase 7 [Lotus japonicus] 72 3e-10 gb|KRH05408.1| hypothetical protein GLYMA_17G2257002, partial [G... 72 3e-10 gb|KOM48835.1| hypothetical protein LR48_Vigan07g253900 [Vigna a... 72 3e-10 gb|AQY72385.1| cytokinin oxidase/dehydrogenase 7-like protein [P... 72 4e-10 ref|XP_017431293.1| PREDICTED: cytokinin dehydrogenase 7-like [V... 72 4e-10 dbj|BAT82480.1| hypothetical protein VIGAN_03250600 [Vigna angul... 72 4e-10 ref|XP_014505113.1| cytokinin dehydrogenase 7 [Vigna radiata var... 72 4e-10 ref|XP_007161054.1| hypothetical protein PHAVU_001G038800g [Phas... 72 4e-10 gb|ABK32520.1| cytokinin oxidase/dehydrogenase 1 [Pisum sativum] 72 4e-10 ref|XP_020206479.1| cytokinin dehydrogenase 7-like [Cajanus caja... 71 5e-10 ref|XP_019434078.1| PREDICTED: cytokinin dehydrogenase 7-like [L... 71 7e-10 ref|XP_020960896.1| cytokinin dehydrogenase 7 isoform X2 [Arachi... 70 1e-09 >gb|KHN17264.1| Cytokinin dehydrogenase 7 [Glycine soja] Length = 286 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKSNIA+FDREVFKKILKHGVGGPILVYPLLRSK Sbjct: 143 FVSKSNIAEFDREVFKKILKHGVGGPILVYPLLRSK 178 >gb|KHN37061.1| Cytokinin dehydrogenase 7 [Glycine soja] Length = 289 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKSNIA+FDREVFKKILKHGVGGPILVYPLLRSK Sbjct: 146 FVSKSNIAEFDREVFKKILKHGVGGPILVYPLLRSK 181 >ref|XP_014625277.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 7-like [Glycine max] Length = 513 Score = 73.6 bits (179), Expect = 8e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKSNIA+FDREVFKKILKHGVGGPILVYPLLRSK Sbjct: 370 FVSKSNIAEFDREVFKKILKHGVGGPILVYPLLRSK 405 >ref|XP_003544550.1| PREDICTED: cytokinin dehydrogenase 7-like [Glycine max] gb|KRH15608.1| hypothetical protein GLYMA_14G099000 [Glycine max] Length = 513 Score = 73.6 bits (179), Expect = 8e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKSNIA+FDREVFKKILKHGVGGPILVYPLLRSK Sbjct: 370 FVSKSNIAEFDREVFKKILKHGVGGPILVYPLLRSK 405 >gb|PNY11662.1| cytokinin dehydrogenase 7-like protein [Trifolium pratense] gb|PNY11897.1| cytokinin dehydrogenase 7-like protein [Trifolium pratense] Length = 405 Score = 73.2 bits (178), Expect = 9e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKS+IADFDREVFKKILKHGVGGPILVYPLLRSK Sbjct: 370 FVSKSDIADFDREVFKKILKHGVGGPILVYPLLRSK 405 >dbj|GAU17639.1| hypothetical protein TSUD_07000 [Trifolium subterraneum] Length = 405 Score = 73.2 bits (178), Expect = 9e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKS+IADFDREVFKKILKHGVGGPILVYPLLRSK Sbjct: 370 FVSKSDIADFDREVFKKILKHGVGGPILVYPLLRSK 405 >ref|XP_003588931.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula] gb|AES59182.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula] Length = 509 Score = 73.2 bits (178), Expect = 1e-10 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKS+IADFDREVFKKILKHGVGGPILVYPLLRSK Sbjct: 370 FVSKSDIADFDREVFKKILKHGVGGPILVYPLLRSK 405 >ref|XP_004498857.1| PREDICTED: cytokinin dehydrogenase 7 [Cicer arietinum] Length = 519 Score = 72.8 bits (177), Expect = 2e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKSNIADFD EVFKKILKHG+GGPILVYPLLRSK Sbjct: 370 FVSKSNIADFDHEVFKKILKHGIGGPILVYPLLRSK 405 >gb|ALS05393.1| cytokinin oxidase/dehydrogenase 7 [Lotus japonicus] Length = 497 Score = 72.0 bits (175), Expect = 3e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKSN+A+FDREVFKKILKHG+GGPILVYPLLRSK Sbjct: 351 FVSKSNMAEFDREVFKKILKHGIGGPILVYPLLRSK 386 >gb|KRH05408.1| hypothetical protein GLYMA_17G2257002, partial [Glycine max] Length = 387 Score = 71.6 bits (174), Expect = 3e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRS 105 FVSKSNIA+FDREVFKKILKHGVGGPILVYPLLRS Sbjct: 353 FVSKSNIAEFDREVFKKILKHGVGGPILVYPLLRS 387 >gb|KOM48835.1| hypothetical protein LR48_Vigan07g253900 [Vigna angularis] Length = 476 Score = 71.6 bits (174), Expect = 3e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKS+IA+FDREVFKKILKHGVGGPILVYPLLRSK Sbjct: 333 FVSKSHIAEFDREVFKKILKHGVGGPILVYPLLRSK 368 >gb|AQY72385.1| cytokinin oxidase/dehydrogenase 7-like protein [Pisum sativum] Length = 509 Score = 71.6 bits (174), Expect = 4e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKS+I DFDREVFKKILKHGVGGPILVYPLLRSK Sbjct: 370 FVSKSDIGDFDREVFKKILKHGVGGPILVYPLLRSK 405 >ref|XP_017431293.1| PREDICTED: cytokinin dehydrogenase 7-like [Vigna angularis] Length = 511 Score = 71.6 bits (174), Expect = 4e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKS+IA+FDREVFKKILKHGVGGPILVYPLLRSK Sbjct: 368 FVSKSHIAEFDREVFKKILKHGVGGPILVYPLLRSK 403 >dbj|BAT82480.1| hypothetical protein VIGAN_03250600 [Vigna angularis var. angularis] Length = 512 Score = 71.6 bits (174), Expect = 4e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKS+IA+FDREVFKKILKHGVGGPILVYPLLRSK Sbjct: 369 FVSKSHIAEFDREVFKKILKHGVGGPILVYPLLRSK 404 >ref|XP_014505113.1| cytokinin dehydrogenase 7 [Vigna radiata var. radiata] Length = 512 Score = 71.6 bits (174), Expect = 4e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKS+IA+FDREVFKKILKHGVGGPILVYPLLRSK Sbjct: 369 FVSKSHIAEFDREVFKKILKHGVGGPILVYPLLRSK 404 >ref|XP_007161054.1| hypothetical protein PHAVU_001G038800g [Phaseolus vulgaris] gb|ESW33048.1| hypothetical protein PHAVU_001G038800g [Phaseolus vulgaris] Length = 512 Score = 71.6 bits (174), Expect = 4e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKS+IA+FDREVFKKILKHGVGGPILVYPLLRSK Sbjct: 369 FVSKSHIAEFDREVFKKILKHGVGGPILVYPLLRSK 404 >gb|ABK32520.1| cytokinin oxidase/dehydrogenase 1 [Pisum sativum] Length = 519 Score = 71.6 bits (174), Expect = 4e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKS+I DFDREVFKKILKHGVGGPILVYPLLRSK Sbjct: 370 FVSKSDIGDFDREVFKKILKHGVGGPILVYPLLRSK 405 >ref|XP_020206479.1| cytokinin dehydrogenase 7-like [Cajanus cajan] gb|KYP75377.1| Cytokinin dehydrogenase 7 [Cajanus cajan] Length = 515 Score = 71.2 bits (173), Expect = 5e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKSNIA+FDR+VFKKILKHGVGGPILVYPLLR+K Sbjct: 372 FVSKSNIAEFDRQVFKKILKHGVGGPILVYPLLRTK 407 >ref|XP_019434078.1| PREDICTED: cytokinin dehydrogenase 7-like [Lupinus angustifolius] gb|OIW21892.1| hypothetical protein TanjilG_13839 [Lupinus angustifolius] Length = 514 Score = 70.9 bits (172), Expect = 7e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 FVSKSNI DFDREVFKKIL+HGVGGPILVYPLLR+K Sbjct: 371 FVSKSNIIDFDREVFKKILRHGVGGPILVYPLLRNK 406 >ref|XP_020960896.1| cytokinin dehydrogenase 7 isoform X2 [Arachis ipaensis] Length = 424 Score = 69.7 bits (169), Expect = 1e-09 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +1 Query: 1 FVSKSNIADFDREVFKKILKHGVGGPILVYPLLRSK 108 F+SKSNIA+FDREVFKKI+K+GVGGPILVYPLLRSK Sbjct: 377 FISKSNIAEFDREVFKKIIKNGVGGPILVYPLLRSK 412