BLASTX nr result
ID: Astragalus22_contig00008125
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00008125 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH56966.1| hypothetical protein GLYMA_05G0301001, partial [G... 65 2e-09 gb|KHN48658.1| LRR receptor-like serine/threonine-protein kinase... 65 2e-09 ref|XP_019451119.1| PREDICTED: LRR receptor-like serine/threonin... 65 2e-09 ref|XP_006579547.1| PREDICTED: LRR receptor-like serine/threonin... 65 2e-09 ref|XP_019451111.1| PREDICTED: LRR receptor-like serine/threonin... 65 2e-09 gb|OIW18480.1| hypothetical protein TanjilG_13232 [Lupinus angus... 65 2e-09 ref|XP_004508778.1| PREDICTED: LRR receptor-like serine/threonin... 63 1e-08 gb|KYP55493.1| LRR receptor-like serine/threonine-protein kinase... 62 2e-08 ref|XP_020225653.1| LRR receptor-like serine/threonine-protein k... 62 2e-08 gb|PNY08249.1| LRR receptor-like serine/threonine-protein kinase... 62 4e-08 gb|KRH03413.1| hypothetical protein GLYMA_17G096500 [Glycine max] 60 9e-08 gb|ACJ37401.1| leucine-rich repeat family protein/protein kinase... 60 9e-08 ref|XP_014507434.1| LRR receptor-like serine/threonine-protein k... 60 9e-08 ref|NP_001242206.2| LRR receptor-like serine/threonine-protein k... 60 9e-08 gb|KHN18521.1| LRR receptor-like serine/threonine-protein kinase... 60 9e-08 gb|KRH03414.1| hypothetical protein GLYMA_17G096500 [Glycine max] 60 9e-08 gb|PKI63182.1| hypothetical protein CRG98_016367, partial [Punic... 56 1e-07 dbj|GAU32829.1| hypothetical protein TSUD_208970 [Trifolium subt... 60 1e-07 gb|OIW19612.1| hypothetical protein TanjilG_18422 [Lupinus angus... 60 1e-07 ref|XP_019438031.1| PREDICTED: LRR receptor-like serine/threonin... 60 1e-07 >gb|KRH56966.1| hypothetical protein GLYMA_05G0301001, partial [Glycine max] Length = 586 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPGN 29 +LNDTK+VLSNWQE DESPCAWTGI CHPG+ Sbjct: 38 TLNDTKNVLSNWQEFDESPCAWTGISCHPGD 68 >gb|KHN48658.1| LRR receptor-like serine/threonine-protein kinase FEI 1 [Glycine soja] Length = 600 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPGN 29 +LNDTK+VLSNWQE DESPCAWTGI CHPG+ Sbjct: 36 TLNDTKNVLSNWQEFDESPCAWTGISCHPGD 66 >ref|XP_019451119.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FEI 1 isoform X2 [Lupinus angustifolius] Length = 601 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPG 32 +LNDTK+VLSNWQELDESPC WTGI CHPG Sbjct: 39 TLNDTKNVLSNWQELDESPCTWTGITCHPG 68 >ref|XP_006579547.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FEI 2 [Glycine max] Length = 602 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPGN 29 +LNDTK+VLSNWQE DESPCAWTGI CHPG+ Sbjct: 38 TLNDTKNVLSNWQEFDESPCAWTGISCHPGD 68 >ref|XP_019451111.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FEI 1 isoform X1 [Lupinus angustifolius] Length = 604 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPG 32 +LNDTK+VLSNWQELDESPC WTGI CHPG Sbjct: 39 TLNDTKNVLSNWQELDESPCTWTGITCHPG 68 >gb|OIW18480.1| hypothetical protein TanjilG_13232 [Lupinus angustifolius] Length = 608 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPG 32 +LNDTK+VLSNWQELDESPC WTGI CHPG Sbjct: 39 TLNDTKNVLSNWQELDESPCTWTGITCHPG 68 >ref|XP_004508778.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FEI 1 [Cicer arietinum] Length = 600 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPG 32 +LNDTK+VL NWQE DESPCAWTGI CHPG Sbjct: 38 TLNDTKNVLGNWQEFDESPCAWTGINCHPG 67 >gb|KYP55493.1| LRR receptor-like serine/threonine-protein kinase FEI 1, partial [Cajanus cajan] Length = 588 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPG 32 +LNDTK+VLSNWQE DESPCAWTGI C+PG Sbjct: 10 TLNDTKNVLSNWQEFDESPCAWTGISCYPG 39 >ref|XP_020225653.1| LRR receptor-like serine/threonine-protein kinase FEI 1 [Cajanus cajan] Length = 602 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPG 32 +LNDTK+VLSNWQE DESPCAWTGI C+PG Sbjct: 38 TLNDTKNVLSNWQEFDESPCAWTGISCYPG 67 >gb|PNY08249.1| LRR receptor-like serine/threonine-protein kinase FEI [Trifolium pratense] Length = 579 Score = 61.6 bits (148), Expect = 4e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPGN 29 +LNDTK+VLSNWQE DES CAWTGI CHPG+ Sbjct: 38 TLNDTKNVLSNWQEFDESHCAWTGISCHPGD 68 >gb|KRH03413.1| hypothetical protein GLYMA_17G096500 [Glycine max] Length = 548 Score = 60.5 bits (145), Expect = 9e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPGN 29 +LNDTK+VLSNWQ+ DES CAWTGI CHPG+ Sbjct: 35 TLNDTKNVLSNWQQFDESHCAWTGISCHPGD 65 >gb|ACJ37401.1| leucine-rich repeat family protein/protein kinase family protein [Glycine max] Length = 580 Score = 60.5 bits (145), Expect = 9e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPGN 29 +LNDTK+VLSNWQ+ DES CAWTGI CHPG+ Sbjct: 67 TLNDTKNVLSNWQQFDESHCAWTGISCHPGD 97 >ref|XP_014507434.1| LRR receptor-like serine/threonine-protein kinase FEI 1 [Vigna radiata var. radiata] Length = 599 Score = 60.5 bits (145), Expect = 9e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPGN 29 +LNDTK+ LSNWQE DE+PC WTGI CHPG+ Sbjct: 36 ALNDTKNALSNWQEFDETPCRWTGISCHPGD 66 >ref|NP_001242206.2| LRR receptor-like serine/threonine-protein kinase FEI 1-like precursor [Glycine max] gb|KRH03415.1| hypothetical protein GLYMA_17G096500 [Glycine max] Length = 602 Score = 60.5 bits (145), Expect = 9e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPGN 29 +LNDTK+VLSNWQ+ DES CAWTGI CHPG+ Sbjct: 38 TLNDTKNVLSNWQQFDESHCAWTGISCHPGD 68 >gb|KHN18521.1| LRR receptor-like serine/threonine-protein kinase FEI 1 [Glycine soja] Length = 602 Score = 60.5 bits (145), Expect = 9e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPGN 29 +LNDTK+VLSNWQ+ DES CAWTGI CHPG+ Sbjct: 38 TLNDTKNVLSNWQQFDESHCAWTGISCHPGD 68 >gb|KRH03414.1| hypothetical protein GLYMA_17G096500 [Glycine max] Length = 603 Score = 60.5 bits (145), Expect = 9e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPGN 29 +LNDTK+VLSNWQ+ DES CAWTGI CHPG+ Sbjct: 38 TLNDTKNVLSNWQQFDESHCAWTGISCHPGD 68 >gb|PKI63182.1| hypothetical protein CRG98_016367, partial [Punica granatum] Length = 74 Score = 56.2 bits (134), Expect = 1e-07 Identities = 21/29 (72%), Positives = 26/29 (89%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHP 35 +LNDTK++LSNWQ LD+SPC WTGI C+P Sbjct: 39 TLNDTKNILSNWQALDDSPCGWTGISCYP 67 >dbj|GAU32829.1| hypothetical protein TSUD_208970 [Trifolium subterraneum] Length = 428 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPGN 29 + NDTK+VLSNWQE DES CAWTGI CHPG+ Sbjct: 38 TFNDTKNVLSNWQEFDESHCAWTGISCHPGD 68 >gb|OIW19612.1| hypothetical protein TanjilG_18422 [Lupinus angustifolius] Length = 595 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPG 32 +LNDT++VLSNWQELDESPC WTGI CH G Sbjct: 39 TLNDTRNVLSNWQELDESPCTWTGITCHLG 68 >ref|XP_019438031.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FEI 1 isoform X2 [Lupinus angustifolius] Length = 598 Score = 60.1 bits (144), Expect = 1e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 121 SLNDTKDVLSNWQELDESPCAWTGIICHPG 32 +LNDT++VLSNWQELDESPC WTGI CH G Sbjct: 39 TLNDTRNVLSNWQELDESPCTWTGITCHLG 68