BLASTX nr result
ID: Astragalus22_contig00007258
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00007258 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY63972.1| hypothetical protein LSAT_7X73160 [Lactuca sativa] 67 8e-10 ref|XP_016452274.1| PREDICTED: topless-related protein 3-like, p... 65 2e-09 ref|XP_018839652.1| PREDICTED: topless-related protein 3-like [J... 65 2e-09 ref|XP_009611828.1| PREDICTED: topless-related protein 3-like is... 65 2e-09 ref|XP_023746783.1| topless-related protein 3-like [Lactuca sativa] 65 2e-09 ref|XP_019187539.1| PREDICTED: topless-related protein 3-like is... 65 2e-09 ref|XP_019187538.1| PREDICTED: topless-related protein 3-like is... 65 2e-09 ref|XP_019254280.1| PREDICTED: topless-related protein 3-like [N... 65 2e-09 ref|XP_009611827.1| PREDICTED: topless-related protein 3-like is... 65 2e-09 ref|XP_018839651.1| PREDICTED: topless-related protein 3-like is... 65 2e-09 gb|KZV19470.1| topless-related protein 3 [Dorcoceras hygrometricum] 65 2e-09 ref|XP_019252622.1| PREDICTED: topless-related protein 3-like is... 65 2e-09 ref|XP_018839650.1| PREDICTED: topless-related protein 3-like is... 65 2e-09 gb|KZV43664.1| topless-related protein 3 [Dorcoceras hygrometricum] 65 2e-09 ref|XP_009766750.1| PREDICTED: topless-related protein 3-like is... 65 2e-09 ref|XP_019252621.1| PREDICTED: topless-related protein 3-like is... 65 2e-09 ref|XP_016494310.1| PREDICTED: topless-related protein 3-like is... 65 2e-09 ref|XP_009766749.1| PREDICTED: topless-related protein 3-like is... 65 2e-09 ref|XP_009616373.1| PREDICTED: topless-related protein 3-like is... 65 2e-09 ref|XP_018630664.1| PREDICTED: topless-related protein 3-like is... 65 2e-09 >gb|PLY63972.1| hypothetical protein LSAT_7X73160 [Lactuca sativa] Length = 1115 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +2 Query: 95 QMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 Q+WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 485 QVWDLTGRKLFNFEGHEAPVYSICPHQKENI 515 >ref|XP_016452274.1| PREDICTED: topless-related protein 3-like, partial [Nicotiana tabacum] Length = 837 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 479 LIKVWDITGRKLFNFEGHEAPVYSICPHQKENI 511 >ref|XP_018839652.1| PREDICTED: topless-related protein 3-like [Juglans regia] Length = 1094 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYSVCPH KENI Sbjct: 441 LIKVWDLTGRKLFNFEGHEAPVYSVCPHHKENI 473 >ref|XP_009611828.1| PREDICTED: topless-related protein 3-like isoform X2 [Nicotiana tomentosiformis] Length = 1101 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 477 LIKVWDITGRKLFNFEGHEAPVYSICPHQKENI 509 >ref|XP_023746783.1| topless-related protein 3-like [Lactuca sativa] Length = 1110 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 478 LIKVWDLTGRKLFNFEGHEAPVYSICPHQKENI 510 >ref|XP_019187539.1| PREDICTED: topless-related protein 3-like isoform X2 [Ipomoea nil] Length = 1126 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 478 LIKVWDLTGRKLFNFEGHEAPVYSICPHQKENI 510 >ref|XP_019187538.1| PREDICTED: topless-related protein 3-like isoform X1 [Ipomoea nil] Length = 1129 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 478 LIKVWDLTGRKLFNFEGHEAPVYSICPHQKENI 510 >ref|XP_019254280.1| PREDICTED: topless-related protein 3-like [Nicotiana attenuata] gb|OIS97592.1| topless-related protein 3 [Nicotiana attenuata] Length = 1129 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 477 LIKVWDVTGRKLFNFEGHEAPVYSICPHQKENI 509 >ref|XP_009611827.1| PREDICTED: topless-related protein 3-like isoform X1 [Nicotiana tomentosiformis] Length = 1129 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 477 LIKVWDITGRKLFNFEGHEAPVYSICPHQKENI 509 >ref|XP_018839651.1| PREDICTED: topless-related protein 3-like isoform X2 [Juglans regia] Length = 1130 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYSVCPH KENI Sbjct: 478 LIKVWDLTGRKLFNFEGHEAPVYSVCPHHKENI 510 >gb|KZV19470.1| topless-related protein 3 [Dorcoceras hygrometricum] Length = 1130 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 478 LIKVWDVTGRKLFNFEGHEAPVYSICPHQKENI 510 >ref|XP_019252622.1| PREDICTED: topless-related protein 3-like isoform X2 [Nicotiana attenuata] Length = 1131 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 479 LIKVWDITGRKLFNFEGHEAPVYSICPHQKENI 511 >ref|XP_018839650.1| PREDICTED: topless-related protein 3-like isoform X1 [Juglans regia] Length = 1131 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYSVCPH KENI Sbjct: 478 LIKVWDLTGRKLFNFEGHEAPVYSVCPHHKENI 510 >gb|KZV43664.1| topless-related protein 3 [Dorcoceras hygrometricum] Length = 1131 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 478 LIKVWDLTGRKLFNFEGHEAPVYSICPHQKENI 510 >ref|XP_009766750.1| PREDICTED: topless-related protein 3-like isoform X2 [Nicotiana sylvestris] Length = 1131 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 479 LIKVWDITGRKLFNFEGHEAPVYSICPHQKENI 511 >ref|XP_019252621.1| PREDICTED: topless-related protein 3-like isoform X1 [Nicotiana attenuata] gb|OIS99858.1| topless-related protein 3 [Nicotiana attenuata] Length = 1132 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 479 LIKVWDITGRKLFNFEGHEAPVYSICPHQKENI 511 >ref|XP_016494310.1| PREDICTED: topless-related protein 3-like isoform X2 [Nicotiana tabacum] Length = 1132 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 480 LIKVWDITGRKLFNFEGHEAPVYSICPHQKENI 512 >ref|XP_009766749.1| PREDICTED: topless-related protein 3-like isoform X1 [Nicotiana sylvestris] Length = 1132 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 479 LIKVWDITGRKLFNFEGHEAPVYSICPHQKENI 511 >ref|XP_009616373.1| PREDICTED: topless-related protein 3-like isoform X2 [Nicotiana tomentosiformis] Length = 1132 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 480 LIKVWDITGRKLFNFEGHEAPVYSICPHQKENI 512 >ref|XP_018630664.1| PREDICTED: topless-related protein 3-like isoform X1 [Nicotiana tomentosiformis] Length = 1133 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 89 LWQMWDNTGRKLFNFEGHEAPVYSVCPHRKENI 187 L ++WD TGRKLFNFEGHEAPVYS+CPH+KENI Sbjct: 480 LIKVWDITGRKLFNFEGHEAPVYSICPHQKENI 512