BLASTX nr result
ID: Astragalus22_contig00006728
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00006728 (344 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007151159.1| hypothetical protein PHAVU_004G022900g [Phas... 61 2e-08 ref|XP_007151160.1| hypothetical protein PHAVU_004G022900g [Phas... 61 2e-08 ref|XP_003618393.2| paired amphipathic helix SIN3-like protein [... 59 8e-08 ref|XP_012568100.1| PREDICTED: paired amphipathic helix protein ... 58 3e-07 ref|XP_012568099.1| PREDICTED: paired amphipathic helix protein ... 58 3e-07 ref|XP_004489351.1| PREDICTED: paired amphipathic helix protein ... 58 3e-07 gb|KYP43754.1| Paired amphipathic helix protein Sin3 [Cajanus ca... 57 5e-07 ref|XP_020238261.1| paired amphipathic helix protein Sin3-like 2... 57 5e-07 ref|XP_020238258.1| paired amphipathic helix protein Sin3-like 2... 57 5e-07 ref|XP_023873644.1| paired amphipathic helix protein Sin3-like 1... 56 1e-06 gb|POE84345.1| paired amphipathic helix protein sin3-like 2 [Que... 56 1e-06 ref|XP_015879243.1| PREDICTED: paired amphipathic helix protein ... 56 1e-06 ref|XP_020968506.1| paired amphipathic helix protein Sin3-like 2... 55 2e-06 ref|XP_016179760.1| paired amphipathic helix protein Sin3-like 2... 55 2e-06 ref|XP_016179759.1| paired amphipathic helix protein Sin3-like 2... 55 2e-06 ref|XP_016179757.1| paired amphipathic helix protein Sin3-like 2... 55 2e-06 gb|PNX78383.1| paired amphipathic helix protein SIN3 2-like [Tri... 52 3e-06 gb|KJB33704.1| hypothetical protein B456_006G027300 [Gossypium r... 55 3e-06 ref|XP_016672852.1| PREDICTED: paired amphipathic helix protein ... 55 3e-06 ref|XP_012483749.1| PREDICTED: paired amphipathic helix protein ... 55 3e-06 >ref|XP_007151159.1| hypothetical protein PHAVU_004G022900g [Phaseolus vulgaris] gb|ESW23153.1| hypothetical protein PHAVU_004G022900g [Phaseolus vulgaris] Length = 1391 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPG 6 MKR RDDIYS S SQFKRPFSSSR DSYGQ VPG Sbjct: 1 MKRARDDIYSASASQFKRPFSSSRADSYGQNQVPG 35 >ref|XP_007151160.1| hypothetical protein PHAVU_004G022900g [Phaseolus vulgaris] gb|ESW23154.1| hypothetical protein PHAVU_004G022900g [Phaseolus vulgaris] Length = 1392 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPG 6 MKR RDDIYS S SQFKRPFSSSR DSYGQ VPG Sbjct: 1 MKRARDDIYSASASQFKRPFSSSRADSYGQNQVPG 35 >ref|XP_003618393.2| paired amphipathic helix SIN3-like protein [Medicago truncatula] gb|AES74611.2| paired amphipathic helix SIN3-like protein [Medicago truncatula] Length = 1387 Score = 59.3 bits (142), Expect = 8e-08 Identities = 29/36 (80%), Positives = 29/36 (80%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPGG 3 MKR RDDIYS S SQFKRPF SSRGDSYGQ PGG Sbjct: 1 MKRARDDIYSASASQFKRPFGSSRGDSYGQG--PGG 34 >ref|XP_012568100.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X3 [Cicer arietinum] Length = 1389 Score = 57.8 bits (138), Expect = 3e-07 Identities = 29/37 (78%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDS-YGQALVPGG 3 MKR RDDIYS S SQFKRPF SSR DS YGQ VPGG Sbjct: 1 MKRVRDDIYSASASQFKRPFGSSRADSGYGQPQVPGG 37 >ref|XP_012568099.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X2 [Cicer arietinum] Length = 1391 Score = 57.8 bits (138), Expect = 3e-07 Identities = 29/37 (78%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDS-YGQALVPGG 3 MKR RDDIYS S SQFKRPF SSR DS YGQ VPGG Sbjct: 1 MKRVRDDIYSASASQFKRPFGSSRADSGYGQPQVPGG 37 >ref|XP_004489351.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X1 [Cicer arietinum] Length = 1407 Score = 57.8 bits (138), Expect = 3e-07 Identities = 29/37 (78%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDS-YGQALVPGG 3 MKR RDDIYS S SQFKRPF SSR DS YGQ VPGG Sbjct: 1 MKRVRDDIYSASASQFKRPFGSSRADSGYGQPQVPGG 37 >gb|KYP43754.1| Paired amphipathic helix protein Sin3 [Cajanus cajan] Length = 1332 Score = 57.0 bits (136), Expect = 5e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPG 6 MKR RDD+YS S QFKRPF+SSR DSYGQ VPG Sbjct: 1 MKRARDDMYSASAPQFKRPFASSRADSYGQNQVPG 35 >ref|XP_020238261.1| paired amphipathic helix protein Sin3-like 2 isoform X2 [Cajanus cajan] Length = 1344 Score = 57.0 bits (136), Expect = 5e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPG 6 MKR RDD+YS S QFKRPF+SSR DSYGQ VPG Sbjct: 1 MKRARDDMYSASAPQFKRPFASSRADSYGQNQVPG 35 >ref|XP_020238258.1| paired amphipathic helix protein Sin3-like 2 isoform X1 [Cajanus cajan] ref|XP_020238259.1| paired amphipathic helix protein Sin3-like 2 isoform X1 [Cajanus cajan] Length = 1395 Score = 57.0 bits (136), Expect = 5e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPG 6 MKR RDD+YS S QFKRPF+SSR DSYGQ VPG Sbjct: 1 MKRARDDMYSASAPQFKRPFASSRADSYGQNQVPG 35 >ref|XP_023873644.1| paired amphipathic helix protein Sin3-like 1 [Quercus suber] ref|XP_023873645.1| paired amphipathic helix protein Sin3-like 1 [Quercus suber] Length = 1443 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPGG 3 MKR RDD+Y GS SQFKRPF SSRGDS+GQ+ VP G Sbjct: 1 MKRLRDDVY-GSSSQFKRPFGSSRGDSFGQSQVPPG 35 >gb|POE84345.1| paired amphipathic helix protein sin3-like 2 [Quercus suber] Length = 1462 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPGG 3 MKR RDD+Y GS SQFKRPF SSRGDS+GQ+ VP G Sbjct: 20 MKRLRDDVY-GSSSQFKRPFGSSRGDSFGQSQVPPG 54 >ref|XP_015879243.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 [Ziziphus jujuba] Length = 1409 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPGG 3 MKR RDD+Y+G+ QFKRPF SSRGDSYG + +PGG Sbjct: 1 MKRIRDDVYAGA--QFKRPFGSSRGDSYGNSSIPGG 34 >ref|XP_020968506.1| paired amphipathic helix protein Sin3-like 2 isoform X4 [Arachis ipaensis] Length = 1368 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPGG 3 MKRTRDD YSGS QFKRPF+SSRGDSYGQ GG Sbjct: 1 MKRTRDDAYSGS--QFKRPFASSRGDSYGQTQGAGG 34 >ref|XP_016179760.1| paired amphipathic helix protein Sin3-like 2 isoform X3 [Arachis ipaensis] Length = 1372 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPGG 3 MKRTRDD YSGS QFKRPF+SSRGDSYGQ GG Sbjct: 1 MKRTRDDAYSGS--QFKRPFASSRGDSYGQTQGAGG 34 >ref|XP_016179759.1| paired amphipathic helix protein Sin3-like 2 isoform X2 [Arachis ipaensis] Length = 1377 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPGG 3 MKRTRDD YSGS QFKRPF+SSRGDSYGQ GG Sbjct: 1 MKRTRDDAYSGS--QFKRPFASSRGDSYGQTQGAGG 34 >ref|XP_016179757.1| paired amphipathic helix protein Sin3-like 2 isoform X1 [Arachis ipaensis] ref|XP_016179758.1| paired amphipathic helix protein Sin3-like 2 isoform X1 [Arachis ipaensis] ref|XP_020968502.1| paired amphipathic helix protein Sin3-like 2 isoform X1 [Arachis ipaensis] ref|XP_020968503.1| paired amphipathic helix protein Sin3-like 2 isoform X1 [Arachis ipaensis] ref|XP_020968504.1| paired amphipathic helix protein Sin3-like 2 isoform X1 [Arachis ipaensis] ref|XP_020968505.1| paired amphipathic helix protein Sin3-like 2 isoform X1 [Arachis ipaensis] Length = 1378 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPGG 3 MKRTRDD YSGS QFKRPF+SSRGDSYGQ GG Sbjct: 1 MKRTRDDAYSGS--QFKRPFASSRGDSYGQTQGAGG 34 >gb|PNX78383.1| paired amphipathic helix protein SIN3 2-like [Trifolium pratense] Length = 93 Score = 52.0 bits (123), Expect = 3e-06 Identities = 27/36 (75%), Positives = 27/36 (75%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPGG 3 MKR RDDIYS S QFKRPF SSRGDSYGQ GG Sbjct: 1 MKRARDDIYSSS--QFKRPFGSSRGDSYGQGPGNGG 34 >gb|KJB33704.1| hypothetical protein B456_006G027300 [Gossypium raimondii] Length = 1283 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPGG 3 MKR RDDIYSGS QFKRPF+SSR +SYGQ +PGG Sbjct: 1 MKRIRDDIYSGS--QFKRPFTSSRAESYGQNQMPGG 34 >ref|XP_016672852.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X4 [Gossypium hirsutum] Length = 1299 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPGG 3 MKR RDDIYSGS QFKRPF+SSR +SYGQ +PGG Sbjct: 1 MKRIRDDIYSGS--QFKRPFTSSRAESYGQNQMPGG 34 >ref|XP_012483749.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X5 [Gossypium raimondii] gb|KJB33705.1| hypothetical protein B456_006G027300 [Gossypium raimondii] gb|KJB33708.1| hypothetical protein B456_006G027300 [Gossypium raimondii] Length = 1299 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 110 MKRTRDDIYSGSGSQFKRPFSSSRGDSYGQALVPGG 3 MKR RDDIYSGS QFKRPF+SSR +SYGQ +PGG Sbjct: 1 MKRIRDDIYSGS--QFKRPFTSSRAESYGQNQMPGG 34