BLASTX nr result
ID: Astragalus22_contig00006423
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00006423 (311 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097631.1| UBP1-associated protein 2A-like [Sesamum ind... 59 7e-08 gb|EMS57767.1| HIV Tat-specific factor 1-like protein [Triticum ... 55 1e-06 >ref|XP_011097631.1| UBP1-associated protein 2A-like [Sesamum indicum] ref|XP_020554360.1| UBP1-associated protein 2A-like [Sesamum indicum] Length = 475 Score = 58.9 bits (141), Expect = 7e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 42 KN*CLSPGSNRGPLVCETSVITNYTTQTML 131 +N CLSPGSN+GPLVCETSVITNYTTQT+L Sbjct: 8 RNICLSPGSNQGPLVCETSVITNYTTQTLL 37 >gb|EMS57767.1| HIV Tat-specific factor 1-like protein [Triticum urartu] Length = 552 Score = 55.5 bits (132), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 42 KN*CLSPGSNRGPLVCETSVITNYTTQTML 131 K+ CLSPGSN GPLVCET+VITNYTTQT+L Sbjct: 523 KHNCLSPGSNWGPLVCETNVITNYTTQTLL 552