BLASTX nr result
ID: Astragalus22_contig00006244
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00006244 (305 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN14278.1| Coatomer subunit epsilon-1 [Glycine soja] 61 2e-09 gb|PNY15464.1| coatomer subunit epsilon-1-like protein [Trifoliu... 61 1e-08 ref|XP_016197815.1| coatomer subunit epsilon-1 [Arachis ipaensis] 61 1e-08 ref|XP_015959413.1| coatomer subunit epsilon-1 [Arachis duranensis] 61 1e-08 ref|XP_006597069.1| PREDICTED: epsilon1-COP isoform X1 [Glycine ... 61 1e-08 ref|XP_004486511.1| PREDICTED: coatomer subunit epsilon-1-like [... 61 1e-08 ref|NP_001236915.1| epsilon1-COP [Glycine max] >gi|7670062|dbj|B... 61 1e-08 ref|XP_020221996.1| coatomer subunit epsilon-1-like [Cajanus cajan] 61 1e-08 gb|KYP62552.1| Coatomer subunit epsilon-1 [Cajanus cajan] 61 1e-08 ref|XP_013463088.1| coatomer epsilon subunit [Medicago truncatul... 60 1e-08 gb|KHN44678.1| Coatomer subunit epsilon-1 [Glycine soja] 60 2e-08 dbj|BAA94965.1| epsilon2-COP, partial [Glycine max] 60 2e-08 ref|NP_001241057.1| epsilon2-COP [Glycine max] >gi|255641517|gb|... 60 2e-08 dbj|GAU41521.1| hypothetical protein TSUD_302600 [Trifolium subt... 60 3e-08 gb|OIV91795.1| hypothetical protein TanjilG_14374 [Lupinus angus... 58 1e-07 ref|XP_019426038.1| PREDICTED: coatomer subunit epsilon-1-like [... 58 1e-07 ref|XP_014519111.1| coatomer subunit epsilon-1 [Vigna radiata va... 57 3e-07 ref|XP_017437378.1| PREDICTED: coatomer subunit epsilon-1-like [... 57 3e-07 ref|XP_007147414.1| hypothetical protein PHAVU_006G122500g [Phas... 57 3e-07 gb|AGV54318.1| epsilon 1-COP [Phaseolus vulgaris] 57 3e-07 >gb|KHN14278.1| Coatomer subunit epsilon-1 [Glycine soja] Length = 158 Score = 60.8 bits (146), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSHP+HVLVKRVS+AEE FDRALQSFS Sbjct: 126 FSQLKLSHPEHVLVKRVSSAEESFDRALQSFS 157 >gb|PNY15464.1| coatomer subunit epsilon-1-like protein [Trifolium pratense] Length = 283 Score = 60.8 bits (146), Expect = 1e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSHPDHVLVKRVSAAEE FDRALQS S Sbjct: 252 FSQLKLSHPDHVLVKRVSAAEESFDRALQSVS 283 >ref|XP_016197815.1| coatomer subunit epsilon-1 [Arachis ipaensis] Length = 289 Score = 60.8 bits (146), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSHPDHVLVKRV+ AEE FDRALQSFS Sbjct: 258 FSQLKLSHPDHVLVKRVTTAEESFDRALQSFS 289 >ref|XP_015959413.1| coatomer subunit epsilon-1 [Arachis duranensis] Length = 289 Score = 60.8 bits (146), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSHPDHVLVKRV+ AEE FDRALQSFS Sbjct: 258 FSQLKLSHPDHVLVKRVTTAEESFDRALQSFS 289 >ref|XP_006597069.1| PREDICTED: epsilon1-COP isoform X1 [Glycine max] gb|KRH11872.1| hypothetical protein GLYMA_15G136100 [Glycine max] Length = 289 Score = 60.8 bits (146), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSHP+HVLVKRVS+AEE FDRALQSFS Sbjct: 257 FSQLKLSHPEHVLVKRVSSAEESFDRALQSFS 288 >ref|XP_004486511.1| PREDICTED: coatomer subunit epsilon-1-like [Cicer arietinum] Length = 289 Score = 60.8 bits (146), Expect = 1e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSHPDHVLVKRVSAAEE FDRALQS S Sbjct: 258 FSQLKLSHPDHVLVKRVSAAEESFDRALQSVS 289 >ref|NP_001236915.1| epsilon1-COP [Glycine max] dbj|BAA94964.1| epsilon1-COP [Glycine max] gb|KRH11873.1| hypothetical protein GLYMA_15G136100 [Glycine max] Length = 290 Score = 60.8 bits (146), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSHP+HVLVKRVS+AEE FDRALQSFS Sbjct: 258 FSQLKLSHPEHVLVKRVSSAEESFDRALQSFS 289 >ref|XP_020221996.1| coatomer subunit epsilon-1-like [Cajanus cajan] Length = 291 Score = 60.8 bits (146), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSHPDHVLVKRVS+AEE FDRALQ FS Sbjct: 259 FSQLKLSHPDHVLVKRVSSAEESFDRALQGFS 290 >gb|KYP62552.1| Coatomer subunit epsilon-1 [Cajanus cajan] Length = 299 Score = 60.8 bits (146), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSHPDHVLVKRVS+AEE FDRALQ FS Sbjct: 267 FSQLKLSHPDHVLVKRVSSAEESFDRALQGFS 298 >ref|XP_013463088.1| coatomer epsilon subunit [Medicago truncatula] emb|CAI29264.1| coatomer epsilon subunit [Medicago truncatula] gb|KEH37133.1| coatomer epsilon subunit [Medicago truncatula] Length = 289 Score = 60.5 bits (145), Expect = 1e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSHPDHVLVKRVSAAEE FDRALQS S Sbjct: 258 FSQLKLSHPDHVLVKRVSAAEESFDRALQSAS 289 >gb|KHN44678.1| Coatomer subunit epsilon-1 [Glycine soja] Length = 282 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLK+SHP+HVLVKRVS+AEE FDRALQSFS Sbjct: 250 FSQLKISHPEHVLVKRVSSAEESFDRALQSFS 281 >dbj|BAA94965.1| epsilon2-COP, partial [Glycine max] Length = 288 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLK+SHP+HVLVKRVS+AEE FDRALQSFS Sbjct: 256 FSQLKISHPEHVLVKRVSSAEESFDRALQSFS 287 >ref|NP_001241057.1| epsilon2-COP [Glycine max] gb|ACU21032.1| unknown [Glycine max] gb|KRH36897.1| hypothetical protein GLYMA_09G030400 [Glycine max] Length = 290 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLK+SHP+HVLVKRVS+AEE FDRALQSFS Sbjct: 258 FSQLKISHPEHVLVKRVSSAEESFDRALQSFS 289 >dbj|GAU41521.1| hypothetical protein TSUD_302600 [Trifolium subterraneum] Length = 297 Score = 59.7 bits (143), Expect = 3e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSHPDHVLVKRV+AAEE FDRALQS S Sbjct: 266 FSQLKLSHPDHVLVKRVTAAEESFDRALQSVS 297 >gb|OIV91795.1| hypothetical protein TanjilG_14374 [Lupinus angustifolius] Length = 283 Score = 57.8 bits (138), Expect = 1e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKL HP+H LVKRVSAAEE FDRALQSFS Sbjct: 252 FSQLKLLHPNHALVKRVSAAEENFDRALQSFS 283 >ref|XP_019426038.1| PREDICTED: coatomer subunit epsilon-1-like [Lupinus angustifolius] Length = 289 Score = 57.8 bits (138), Expect = 1e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKL HP+H LVKRVSAAEE FDRALQSFS Sbjct: 258 FSQLKLLHPNHALVKRVSAAEENFDRALQSFS 289 >ref|XP_014519111.1| coatomer subunit epsilon-1 [Vigna radiata var. radiata] dbj|BAT87734.1| hypothetical protein VIGAN_05113000 [Vigna angularis var. angularis] Length = 290 Score = 57.0 bits (136), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSH DHVLVKRV++AEE FDRALQ+FS Sbjct: 258 FSQLKLSHADHVLVKRVTSAEESFDRALQTFS 289 >ref|XP_017437378.1| PREDICTED: coatomer subunit epsilon-1-like [Vigna angularis] gb|KOM53081.1| hypothetical protein LR48_Vigan09g174000 [Vigna angularis] Length = 290 Score = 57.0 bits (136), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSH DHVLVKRV++AEE FDRALQ+FS Sbjct: 258 FSQLKLSHADHVLVKRVTSAEESFDRALQTFS 289 >ref|XP_007147414.1| hypothetical protein PHAVU_006G122500g [Phaseolus vulgaris] gb|ESW19408.1| hypothetical protein PHAVU_006G122500g [Phaseolus vulgaris] Length = 290 Score = 57.0 bits (136), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSH DHVLVKRV++AEE FDRALQ+FS Sbjct: 258 FSQLKLSHADHVLVKRVTSAEESFDRALQTFS 289 >gb|AGV54318.1| epsilon 1-COP [Phaseolus vulgaris] Length = 290 Score = 57.0 bits (136), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 FSQLKLSHPDHVLVKRVSAAEEGFDRALQSFS 98 FSQLKLSH DHVLVKRV++AEE FDRALQ+FS Sbjct: 258 FSQLKLSHADHVLVKRVTSAEESFDRALQTFS 289