BLASTX nr result
ID: Astragalus22_contig00006054
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00006054 (332 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA36415.1| lectin [Robinia pseudoacacia] 57 2e-07 >dbj|BAA36415.1| lectin [Robinia pseudoacacia] Length = 285 Score = 57.4 bits (137), Expect = 2e-07 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 2/42 (4%) Frame = -3 Query: 327 VGFSASTGATEGFVESHDILSWSFELSLPD--GDGLEKNVLR 208 VGFSA+TG +EG VESHDILSWSF +LPD D L N+LR Sbjct: 241 VGFSATTGLSEGLVESHDILSWSFHSNLPDSSSDALANNILR 282