BLASTX nr result
ID: Astragalus22_contig00005873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00005873 (328 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013454799.1| disease resistance response protein [Medicag... 109 1e-27 gb|AFK45947.1| unknown [Medicago truncatula] 108 2e-27 ref|XP_013454798.1| disease resistance response protein [Medicag... 108 2e-27 ref|XP_004514253.1| PREDICTED: dirigent protein 22-like [Cicer a... 105 5e-26 ref|XP_013454793.1| disease resistance response protein [Medicag... 102 6e-25 gb|PNX78553.1| disease resistance response protein 206-like prot... 100 2e-24 ref|XP_004514254.1| PREDICTED: dirigent protein 22-like [Cicer a... 100 7e-24 gb|PNX62990.1| disease resistance response protein 206-like prot... 99 9e-24 ref|XP_013454795.1| disease resistance response protein [Medicag... 99 9e-24 gb|PNX77156.1| disease resistance response protein [Trifolium pr... 97 5e-23 dbj|GAU13889.1| hypothetical protein TSUD_262160 [Trifolium subt... 97 7e-23 ref|XP_013454796.1| disease resistance-responsive, dirigent doma... 97 1e-22 gb|AFK42454.1| unknown [Lotus japonicus] 95 6e-22 gb|AFK39378.1| unknown [Lotus japonicus] 95 6e-22 ref|XP_013454794.1| disease resistance response protein [Medicag... 93 2e-21 ref|XP_015950525.1| dirigent protein 22 [Arachis duranensis] 93 3e-21 gb|PNX74029.1| hypothetical protein L195_g029940 [Trifolium prat... 92 5e-21 ref|NP_001240070.1| dirigent family protein precursor [Glycine m... 92 8e-21 ref|XP_016184022.1| dirigent protein 22 [Arachis ipaensis] 91 1e-20 ref|XP_014492695.1| dirigent protein 22 [Vigna radiata var. radi... 89 9e-20 >ref|XP_013454799.1| disease resistance response protein [Medicago truncatula] gb|KEH28830.1| disease resistance response protein [Medicago truncatula] Length = 197 Score = 109 bits (272), Expect = 1e-27 Identities = 46/57 (80%), Positives = 56/57 (98%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 E+++TFDFVRPIDRKLLG+NKKEKLSHF+FYWHD+LSG+NPTS+AI+PPS K+NSTT Sbjct: 27 EKQDTFDFVRPIDRKLLGLNKKEKLSHFRFYWHDVLSGKNPTSVAIIPPSSKVNSTT 83 >gb|AFK45947.1| unknown [Medicago truncatula] Length = 196 Score = 108 bits (271), Expect = 2e-27 Identities = 48/57 (84%), Positives = 55/57 (96%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 E+E+TFDFVRPIDRKLLG+NKKEKLSHFK YWHDI+SG+NPTS+AIVPPS K+NSTT Sbjct: 26 EKEDTFDFVRPIDRKLLGLNKKEKLSHFKLYWHDIVSGKNPTSVAIVPPSSKVNSTT 82 >ref|XP_013454798.1| disease resistance response protein [Medicago truncatula] gb|KEH28829.1| disease resistance response protein [Medicago truncatula] Length = 196 Score = 108 bits (271), Expect = 2e-27 Identities = 48/57 (84%), Positives = 55/57 (96%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 E+E+TFDFVRPIDRKLLG+NKKEKLSHFK YWHDI+SG+NPTS+AIVPPS K+NSTT Sbjct: 26 EKEDTFDFVRPIDRKLLGLNKKEKLSHFKLYWHDIVSGKNPTSVAIVPPSSKVNSTT 82 >ref|XP_004514253.1| PREDICTED: dirigent protein 22-like [Cicer arietinum] Length = 199 Score = 105 bits (261), Expect = 5e-26 Identities = 45/57 (78%), Positives = 56/57 (98%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 ++EETF+FVRPIDRKLLG+NKKE+LSHF+FYWHDILSG+NPTSIA+VPP+ K+NST+ Sbjct: 29 QKEETFEFVRPIDRKLLGLNKKEQLSHFRFYWHDILSGKNPTSIAVVPPTSKLNSTS 85 >ref|XP_013454793.1| disease resistance response protein [Medicago truncatula] gb|KEH28824.1| disease resistance response protein [Medicago truncatula] Length = 199 Score = 102 bits (254), Expect = 6e-25 Identities = 45/57 (78%), Positives = 53/57 (92%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 E++ETFDFVRPIDRKLL +NKKEKLSHF+FYWHDILSG+NPT+I IVPP K+N+TT Sbjct: 29 EKQETFDFVRPIDRKLLSLNKKEKLSHFRFYWHDILSGKNPTAITIVPPPLKLNTTT 85 >gb|PNX78553.1| disease resistance response protein 206-like protein [Trifolium pratense] Length = 197 Score = 100 bits (250), Expect = 2e-24 Identities = 46/57 (80%), Positives = 55/57 (96%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 E+++TFDFVRPIDRKLLG++KKEKLSHFKFYWHDILSG+NPTSI+I+PP+ INSTT Sbjct: 29 EKDDTFDFVRPIDRKLLGLHKKEKLSHFKFYWHDILSGKNPTSISIIPPT--INSTT 83 >ref|XP_004514254.1| PREDICTED: dirigent protein 22-like [Cicer arietinum] Length = 202 Score = 99.8 bits (247), Expect = 7e-24 Identities = 43/57 (75%), Positives = 54/57 (94%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 ++E+TF+FVRPIDRKLLG+NKKEKLSHFKFYWHDILSG+NPT+I I PP+ K+N++T Sbjct: 32 QKEDTFEFVRPIDRKLLGLNKKEKLSHFKFYWHDILSGKNPTTITINPPTLKLNTST 88 >gb|PNX62990.1| disease resistance response protein 206-like protein [Trifolium pratense] Length = 199 Score = 99.4 bits (246), Expect = 9e-24 Identities = 43/61 (70%), Positives = 54/61 (88%) Frame = -1 Query: 184 PKQQEEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINST 5 P ++++TF+FVRP+DRKLLGINKKEKLSHFKFYWHDI SG+N +S+ +VPPS K+NST Sbjct: 25 PPSSQKDDTFEFVRPMDRKLLGINKKEKLSHFKFYWHDIGSGKNQSSVMVVPPSLKLNST 84 Query: 4 T 2 T Sbjct: 85 T 85 >ref|XP_013454795.1| disease resistance response protein [Medicago truncatula] gb|KEH28826.1| disease resistance response protein [Medicago truncatula] Length = 199 Score = 99.4 bits (246), Expect = 9e-24 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINST 5 E EETFDFVRPIDRKLLG+NKKEKLSHF+FYWHDILSG NPT+I IV P K++ST Sbjct: 27 ENEETFDFVRPIDRKLLGLNKKEKLSHFRFYWHDILSGNNPTTITIVQPPLKLHST 82 >gb|PNX77156.1| disease resistance response protein [Trifolium pratense] Length = 198 Score = 97.4 bits (241), Expect = 5e-23 Identities = 43/57 (75%), Positives = 53/57 (92%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 ++E+TFDFVRPI+ KLLG+NKKEKLSHF+FYWHDILSG+NPTSI IVPP+ +N+TT Sbjct: 28 QKEDTFDFVRPINPKLLGLNKKEKLSHFRFYWHDILSGKNPTSIIIVPPTLILNTTT 84 >dbj|GAU13889.1| hypothetical protein TSUD_262160 [Trifolium subterraneum] Length = 197 Score = 97.1 bits (240), Expect = 7e-23 Identities = 42/57 (73%), Positives = 53/57 (92%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 E+++TFDFVRPI+ KLLG+NKKEKLSHF+FYWHDILSG+NPTS+ IVPP+ +N+TT Sbjct: 27 EKDDTFDFVRPINPKLLGLNKKEKLSHFRFYWHDILSGKNPTSVIIVPPTLILNTTT 83 >ref|XP_013454796.1| disease resistance-responsive, dirigent domain protein [Medicago truncatula] gb|KEH28827.1| disease resistance-responsive, dirigent domain protein [Medicago truncatula] Length = 196 Score = 96.7 bits (239), Expect = 1e-22 Identities = 43/57 (75%), Positives = 52/57 (91%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 E+++T DFVRPIDRKLLG+NKKEKLSHFKFYWHDI+SG+NPTSI ++PPS +NS T Sbjct: 28 EKQDTVDFVRPIDRKLLGLNKKEKLSHFKFYWHDIVSGKNPTSIVVIPPS--LNSNT 82 >gb|AFK42454.1| unknown [Lotus japonicus] Length = 200 Score = 94.7 bits (234), Expect = 6e-22 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 E+E T DFVRPIDRKLLG++KKEKLSHFKFYWHDILSG++PTS+ IVPP+ K NSTT Sbjct: 31 EQEGTSDFVRPIDRKLLGLHKKEKLSHFKFYWHDILSGRSPTSVPIVPPAYK-NSTT 86 >gb|AFK39378.1| unknown [Lotus japonicus] Length = 200 Score = 94.7 bits (234), Expect = 6e-22 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 E+E T DFVRPIDRKLLG++KKEKLSHFKFYWHDILSG++PTS+ IVPP+ K NSTT Sbjct: 31 EQEGTSDFVRPIDRKLLGLHKKEKLSHFKFYWHDILSGRSPTSVPIVPPAYK-NSTT 86 >ref|XP_013454794.1| disease resistance response protein [Medicago truncatula] gb|AFK35208.1| unknown [Medicago truncatula] gb|KEH28825.1| disease resistance response protein [Medicago truncatula] Length = 199 Score = 93.2 bits (230), Expect = 2e-21 Identities = 42/57 (73%), Positives = 51/57 (89%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 E +TF+FVRPIDRKLL + KKEKLSHF+FYWHDI+SG+NPTS+A+VPP K+NSTT Sbjct: 30 ENGDTFEFVRPIDRKLLSL-KKEKLSHFRFYWHDIVSGKNPTSVAVVPPPMKLNSTT 85 >ref|XP_015950525.1| dirigent protein 22 [Arachis duranensis] Length = 190 Score = 92.8 bits (229), Expect = 3e-21 Identities = 42/52 (80%), Positives = 48/52 (92%), Gaps = 1/52 (1%) Frame = -1 Query: 154 DFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIV-PPSPKINSTT 2 DFVRPIDR LLG+NKKEK+SHFKFYWHDILSGQNPTS+++V PP KIN+TT Sbjct: 25 DFVRPIDRSLLGLNKKEKVSHFKFYWHDILSGQNPTSVSVVTPPMTKINTTT 76 >gb|PNX74029.1| hypothetical protein L195_g029940 [Trifolium pratense] gb|PNX80506.1| hypothetical protein L195_g036508 [Trifolium pratense] gb|PNY11694.1| hypothetical protein L195_g008306 [Trifolium pratense] Length = 198 Score = 92.4 bits (228), Expect = 5e-21 Identities = 40/57 (70%), Positives = 52/57 (91%) Frame = -1 Query: 172 EEEETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 + ++TF+FVRP+DRKLLG+ KKEKLSHFKFYWHD +SG+NP+S+ I+PPS K+NSTT Sbjct: 29 QNDDTFEFVRPMDRKLLGL-KKEKLSHFKFYWHDTVSGKNPSSVTIIPPSLKLNSTT 84 >ref|NP_001240070.1| dirigent family protein precursor [Glycine max] gb|ACU19866.1| unknown [Glycine max] gb|KRH76049.1| hypothetical protein GLYMA_01G127400 [Glycine max] Length = 194 Score = 91.7 bits (226), Expect = 8e-21 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = -1 Query: 166 EETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 +E F R IDRKLLG+ +KEKLSHFKFYWHDI+SG+NPTS+A+VPP PK+N+TT Sbjct: 26 QEDTSFGRAIDRKLLGLKRKEKLSHFKFYWHDIVSGRNPTSVAVVPPPPKVNTTT 80 >ref|XP_016184022.1| dirigent protein 22 [Arachis ipaensis] Length = 190 Score = 91.3 bits (225), Expect = 1e-20 Identities = 41/52 (78%), Positives = 48/52 (92%), Gaps = 1/52 (1%) Frame = -1 Query: 154 DFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIV-PPSPKINSTT 2 DFVRPIDR LLG+NK+EK+SHFKFYWHDILSGQNPTS+++V PP KIN+TT Sbjct: 25 DFVRPIDRSLLGLNKEEKVSHFKFYWHDILSGQNPTSVSVVTPPMTKINTTT 76 >ref|XP_014492695.1| dirigent protein 22 [Vigna radiata var. radiata] Length = 191 Score = 89.0 bits (219), Expect = 9e-20 Identities = 38/55 (69%), Positives = 48/55 (87%) Frame = -1 Query: 166 EETFDFVRPIDRKLLGINKKEKLSHFKFYWHDILSGQNPTSIAIVPPSPKINSTT 2 +E +F +DRKLLG+ KKEKLSHFKFYWHDILSG+NPTS+++VPPS K+N+TT Sbjct: 23 QEDSEFGHAVDRKLLGLKKKEKLSHFKFYWHDILSGRNPTSVSVVPPSLKLNTTT 77