BLASTX nr result
ID: Astragalus22_contig00005778
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00005778 (615 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX57757.1| TPR protein, partial [Trifolium pratense] >gi|133... 68 2e-11 gb|PNX63549.1| TPR protein, partial [Trifolium pratense] >gi|133... 68 2e-11 ref|XP_016176835.1| uncharacterized protein ycf37 isoform X2 [Ar... 70 4e-11 ref|XP_015942585.1| uncharacterized protein ycf37 isoform X2 [Ar... 70 4e-11 ref|XP_015942584.2| uncharacterized protein LOC107467879 isoform... 70 9e-11 ref|XP_016176834.2| uncharacterized protein LOC107619124 isoform... 70 9e-11 ref|XP_021600083.1| tetratricopeptide repeat domain-containing p... 69 1e-10 gb|KJB81358.1| hypothetical protein B456_013G140800 [Gossypium r... 69 1e-10 ref|XP_015579453.1| PREDICTED: uncharacterized protein ycf37 iso... 69 2e-10 gb|KJB81357.1| hypothetical protein B456_013G140800 [Gossypium r... 69 2e-10 ref|XP_018434001.1| PREDICTED: uncharacterized protein ycf37 iso... 68 2e-10 ref|XP_013726013.1| tetratricopeptide repeat domain-containing p... 68 2e-10 ref|XP_013697773.1| tetratricopeptide repeat domain-containing p... 68 2e-10 ref|XP_013637715.1| PREDICTED: uncharacterized protein ycf37 iso... 68 2e-10 ref|XP_006416170.1| tetratricopeptide repeat domain-containing p... 68 2e-10 dbj|GAV59257.1| TPR_11 domain-containing protein [Cephalotus fol... 69 2e-10 ref|XP_020870984.1| uncharacterized protein ycf37 isoform X2 [Ar... 68 2e-10 ref|XP_009115612.1| PREDICTED: uncharacterized protein ycf37 iso... 68 2e-10 ref|XP_021600082.1| tetratricopeptide repeat domain-containing p... 69 2e-10 gb|KJB81360.1| hypothetical protein B456_013G140800 [Gossypium r... 69 2e-10 >gb|PNX57757.1| TPR protein, partial [Trifolium pratense] gb|PNX79729.1| TPR protein, partial [Trifolium pratense] Length = 89 Score = 67.8 bits (164), Expect = 2e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGV 498 ++KKE+ ALKAFEEVLLFDPNNKIARPRRDALK+LVG+ Sbjct: 39 DSKKEYVSALKAFEEVLLFDPNNKIARPRRDALKELVGM 77 >gb|PNX63549.1| TPR protein, partial [Trifolium pratense] gb|PNX66546.1| TPR protein, partial [Trifolium pratense] Length = 94 Score = 67.8 bits (164), Expect = 2e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGV 498 ++KKE+ ALKAFEEVLLFDPNNKIARPRRDALK+LVG+ Sbjct: 44 DSKKEYVSALKAFEEVLLFDPNNKIARPRRDALKELVGM 82 >ref|XP_016176835.1| uncharacterized protein ycf37 isoform X2 [Arachis ipaensis] Length = 257 Score = 70.5 bits (171), Expect = 4e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KKE+K ALKAFEEVLLFDPNNKIARPRRDALKD V +Y Sbjct: 208 ENKKEYKAALKAFEEVLLFDPNNKIARPRRDALKDRVEMY 247 >ref|XP_015942585.1| uncharacterized protein ycf37 isoform X2 [Arachis duranensis] Length = 257 Score = 70.5 bits (171), Expect = 4e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KKE+K ALKAFEEVLLFDPNNKIARPRRDALKD V +Y Sbjct: 208 ENKKEYKAALKAFEEVLLFDPNNKIARPRRDALKDRVEMY 247 >ref|XP_015942584.2| uncharacterized protein LOC107467879 isoform X1 [Arachis duranensis] Length = 354 Score = 70.5 bits (171), Expect = 9e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KKE+K ALKAFEEVLLFDPNNKIARPRRDALKD V +Y Sbjct: 305 ENKKEYKAALKAFEEVLLFDPNNKIARPRRDALKDRVEMY 344 >ref|XP_016176834.2| uncharacterized protein LOC107619124 isoform X1 [Arachis ipaensis] Length = 354 Score = 70.5 bits (171), Expect = 9e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KKE+K ALKAFEEVLLFDPNNKIARPRRDALKD V +Y Sbjct: 305 ENKKEYKAALKAFEEVLLFDPNNKIARPRRDALKDRVEMY 344 >ref|XP_021600083.1| tetratricopeptide repeat domain-containing protein PYG7, chloroplastic isoform X2 [Manihot esculenta] gb|OAY23697.1| hypothetical protein MANES_18G099900 [Manihot esculenta] Length = 253 Score = 69.3 bits (168), Expect = 1e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KK+ K ALKAFEEVLLFDPNNK+ARPRRDALKDLV +Y Sbjct: 204 EKKKDLKSALKAFEEVLLFDPNNKVARPRRDALKDLVQMY 243 >gb|KJB81358.1| hypothetical protein B456_013G140800 [Gossypium raimondii] Length = 211 Score = 68.6 bits (166), Expect = 1e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KK++K ALKAFEEVLLFDPNNKIARPRRDALKD V +Y Sbjct: 162 EKKKDYKSALKAFEEVLLFDPNNKIARPRRDALKDRVEMY 201 >ref|XP_015579453.1| PREDICTED: uncharacterized protein ycf37 isoform X3 [Ricinus communis] Length = 227 Score = 68.6 bits (166), Expect = 2e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KKE+K ALKAFEEVLLFDPNNK+ARPRRDA+KD V +Y Sbjct: 177 EKKKEYKSALKAFEEVLLFDPNNKVARPRRDAMKDRVQMY 216 >gb|KJB81357.1| hypothetical protein B456_013G140800 [Gossypium raimondii] gb|KJB81359.1| hypothetical protein B456_013G140800 [Gossypium raimondii] Length = 232 Score = 68.6 bits (166), Expect = 2e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KK++K ALKAFEEVLLFDPNNKIARPRRDALKD V +Y Sbjct: 183 EKKKDYKSALKAFEEVLLFDPNNKIARPRRDALKDRVEMY 222 >ref|XP_018434001.1| PREDICTED: uncharacterized protein ycf37 isoform X2 [Raphanus sativus] Length = 211 Score = 68.2 bits (165), Expect = 2e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KKE LALKAFEEVLLFDPNNK+ARPRRDALKD V +Y Sbjct: 161 EKKKELPLALKAFEEVLLFDPNNKVARPRRDALKDRVKLY 200 >ref|XP_013726013.1| tetratricopeptide repeat domain-containing protein PYG7, chloroplastic-like isoform X2 [Brassica napus] Length = 211 Score = 68.2 bits (165), Expect = 2e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KKE LALKAFEEVLLFDPNNK+ARPRRDALKD V +Y Sbjct: 161 EKKKELPLALKAFEEVLLFDPNNKVARPRRDALKDRVKLY 200 >ref|XP_013697773.1| tetratricopeptide repeat domain-containing protein PYG7, chloroplastic-like isoform X2 [Brassica napus] ref|XP_013725971.1| tetratricopeptide repeat domain-containing protein PYG7, chloroplastic-like isoform X2 [Brassica napus] Length = 211 Score = 68.2 bits (165), Expect = 2e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KKE LALKAFEEVLLFDPNNK+ARPRRDALKD V +Y Sbjct: 161 EKKKELPLALKAFEEVLLFDPNNKVARPRRDALKDRVKLY 200 >ref|XP_013637715.1| PREDICTED: uncharacterized protein ycf37 isoform X2 [Brassica oleracea var. oleracea] ref|XP_013697281.1| tetratricopeptide repeat domain-containing protein PYG7, chloroplastic isoform X2 [Brassica napus] Length = 211 Score = 68.2 bits (165), Expect = 2e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KKE LALKAFEEVLLFDPNNK+ARPRRDALKD V +Y Sbjct: 161 EKKKELPLALKAFEEVLLFDPNNKVARPRRDALKDRVKLY 200 >ref|XP_006416170.1| tetratricopeptide repeat domain-containing protein PYG7, chloroplastic isoform X2 [Eutrema salsugineum] gb|ESQ34523.1| hypothetical protein EUTSA_v10008318mg [Eutrema salsugineum] Length = 211 Score = 68.2 bits (165), Expect = 2e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KKE LALKAFEEVLLFDPNNK+ARPRRDALKD V +Y Sbjct: 161 EKKKELPLALKAFEEVLLFDPNNKVARPRRDALKDRVKLY 200 >dbj|GAV59257.1| TPR_11 domain-containing protein [Cephalotus follicularis] Length = 296 Score = 69.3 bits (168), Expect = 2e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E K +FK ALKAF+EVLLFDPNNK+ARPRRDALKD VG+Y Sbjct: 247 EKKNDFKSALKAFDEVLLFDPNNKVARPRRDALKDRVGMY 286 >ref|XP_020870984.1| uncharacterized protein ycf37 isoform X2 [Arabidopsis lyrata subsp. lyrata] Length = 213 Score = 68.2 bits (165), Expect = 2e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KKE LALKAFEEVLLFDPNNK+ARPRRDALKD V +Y Sbjct: 163 EKKKELPLALKAFEEVLLFDPNNKVARPRRDALKDRVKLY 202 >ref|XP_009115612.1| PREDICTED: uncharacterized protein ycf37 isoform X2 [Brassica rapa] Length = 226 Score = 68.2 bits (165), Expect = 2e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KKE LALKAFEEVLLFDPNNK+ARPRRDALKD V +Y Sbjct: 176 EKKKELPLALKAFEEVLLFDPNNKVARPRRDALKDRVKLY 215 >ref|XP_021600082.1| tetratricopeptide repeat domain-containing protein PYG7, chloroplastic isoform X1 [Manihot esculenta] gb|OAY23696.1| hypothetical protein MANES_18G099900 [Manihot esculenta] Length = 332 Score = 69.3 bits (168), Expect = 2e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KK+ K ALKAFEEVLLFDPNNK+ARPRRDALKDLV +Y Sbjct: 283 EKKKDLKSALKAFEEVLLFDPNNKVARPRRDALKDLVQMY 322 >gb|KJB81360.1| hypothetical protein B456_013G140800 [Gossypium raimondii] Length = 257 Score = 68.6 bits (166), Expect = 2e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 614 ETKKEFKLALKAFEEVLLFDPNNKIARPRRDALKDLVGVY 495 E KK++K ALKAFEEVLLFDPNNKIARPRRDALKD V +Y Sbjct: 208 EKKKDYKSALKAFEEVLLFDPNNKIARPRRDALKDRVEMY 247