BLASTX nr result
ID: Astragalus22_contig00005070
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00005070 (454 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA11387.1| human immunodeficiency virus Tat binding protein... 111 2e-29 gb|KYP54318.1| 26S protease regulatory subunit 6A isogeny [Cajan... 110 5e-29 ref|XP_023882826.1| 26S proteasome regulatory subunit 6A homolog... 110 1e-28 gb|AFK49003.1| unknown [Lotus japonicus] 110 4e-28 gb|PIN10026.1| Proteasome endopeptidase complex [Handroanthus im... 111 4e-28 ref|XP_010103420.1| 26S proteasome regulatory subunit 6A homolog... 111 4e-28 gb|AFK41701.1| unknown [Lotus japonicus] 111 7e-28 gb|POE72563.1| isoform 2 of 26s protease regulatory subunit 6a l... 110 1e-27 ref|XP_020680450.1| 26S protease regulatory subunit 6A homolog [... 108 2e-27 gb|ESQ35967.1| hypothetical protein EUTSA_v10009281mg [Eutrema s... 106 2e-27 gb|OAY67625.1| 26S protease regulatory subunit 6A [Ananas comosus] 108 6e-27 gb|AQL01693.1| 26S protease regulatory subunit 6A homolog A [Zea... 107 1e-26 dbj|BAB78504.1| 26S proteasome regulatory particle triple-A ATPa... 108 1e-26 ref|XP_011648845.1| PREDICTED: 26S protease regulatory subunit 6... 111 1e-26 ref|XP_008454060.1| PREDICTED: 26S protease regulatory subunit 6... 111 1e-26 gb|PPS06949.1| hypothetical protein GOBAR_AA13717 [Gossypium bar... 111 1e-26 gb|AQK84079.1| 26S protease regulatory subunit 6A homolog A [Zea... 107 2e-26 ref|XP_022895955.1| 26S proteasome regulatory subunit 6A homolog... 111 2e-26 gb|KZV43712.1| 26S protease regulatory subunit 6A [Dorcoceras hy... 111 2e-26 gb|KJB81028.1| hypothetical protein B456_013G125900 [Gossypium r... 111 2e-26 >dbj|BAA11387.1| human immunodeficiency virus Tat binding protein 1, partial [Brassica rapa] Length = 68 Score = 111 bits (278), Expect = 2e-29 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 14 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 68 >gb|KYP54318.1| 26S protease regulatory subunit 6A isogeny [Cajanus cajan] Length = 67 Score = 110 bits (275), Expect = 5e-29 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 13 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 67 >ref|XP_023882826.1| 26S proteasome regulatory subunit 6A homolog [Quercus suber] Length = 97 Score = 110 bits (275), Expect = 1e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 43 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 97 >gb|AFK49003.1| unknown [Lotus japonicus] Length = 130 Score = 110 bits (274), Expect = 4e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 449 RSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 RSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 77 RSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 130 >gb|PIN10026.1| Proteasome endopeptidase complex [Handroanthus impetiginosus] Length = 181 Score = 111 bits (278), Expect = 4e-28 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 127 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 181 >ref|XP_010103420.1| 26S proteasome regulatory subunit 6A homolog [Morus notabilis] gb|EXB95775.1| 26S protease regulatory subunit 6A-A-like protein [Morus notabilis] Length = 181 Score = 111 bits (278), Expect = 4e-28 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 127 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 181 >gb|AFK41701.1| unknown [Lotus japonicus] Length = 204 Score = 111 bits (278), Expect = 7e-28 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 150 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 204 >gb|POE72563.1| isoform 2 of 26s protease regulatory subunit 6a like [Quercus suber] Length = 190 Score = 110 bits (275), Expect = 1e-27 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 136 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 190 >ref|XP_020680450.1| 26S protease regulatory subunit 6A homolog [Dendrobium catenatum] gb|PKU85631.1| 26S protease regulatory subunit 6A like A [Dendrobium catenatum] Length = 117 Score = 108 bits (269), Expect = 2e-27 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEV HEDFNEGIIQVQAKKKASLNYYA Sbjct: 63 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVIHEDFNEGIIQVQAKKKASLNYYA 117 >gb|ESQ35967.1| hypothetical protein EUTSA_v10009281mg [Eutrema salsugineum] Length = 67 Score = 106 bits (264), Expect = 2e-27 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRR+ATEVNHEDFN+GIIQVQAKKKA LNYYA Sbjct: 13 ARSTDDFNGAQLKAVCVEAGMLALRRNATEVNHEDFNQGIIQVQAKKKAILNYYA 67 >gb|OAY67625.1| 26S protease regulatory subunit 6A [Ananas comosus] Length = 165 Score = 108 bits (269), Expect = 6e-27 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEV HEDFNEGIIQVQAKKK+SLNYYA Sbjct: 111 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVTHEDFNEGIIQVQAKKKSSLNYYA 165 >gb|AQL01693.1| 26S protease regulatory subunit 6A homolog A [Zea mays] Length = 176 Score = 107 bits (268), Expect = 1e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEV HEDFNEGI+QVQAKKK+SLNYYA Sbjct: 122 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVTHEDFNEGIVQVQAKKKSSLNYYA 176 >dbj|BAB78504.1| 26S proteasome regulatory particle triple-A ATPase subunit5b, partial [Oryza sativa Japonica Group] Length = 194 Score = 108 bits (269), Expect = 1e-26 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEV HEDFNEGIIQVQAKKK+SLNYYA Sbjct: 140 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVTHEDFNEGIIQVQAKKKSSLNYYA 194 >ref|XP_011648845.1| PREDICTED: 26S protease regulatory subunit 6A homolog isoform X2 [Cucumis sativus] Length = 347 Score = 111 bits (278), Expect = 1e-26 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 293 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 347 >ref|XP_008454060.1| PREDICTED: 26S protease regulatory subunit 6A homolog isoform X2 [Cucumis melo] Length = 347 Score = 111 bits (278), Expect = 1e-26 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 293 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 347 >gb|PPS06949.1| hypothetical protein GOBAR_AA13717 [Gossypium barbadense] Length = 348 Score = 111 bits (278), Expect = 1e-26 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 294 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 348 >gb|AQK84079.1| 26S protease regulatory subunit 6A homolog A [Zea mays] Length = 191 Score = 107 bits (268), Expect = 2e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEV HEDFNEGI+QVQAKKK+SLNYYA Sbjct: 137 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVTHEDFNEGIVQVQAKKKSSLNYYA 191 >ref|XP_022895955.1| 26S proteasome regulatory subunit 6A homolog [Olea europaea var. sylvestris] Length = 366 Score = 111 bits (278), Expect = 2e-26 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 312 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 366 >gb|KZV43712.1| 26S protease regulatory subunit 6A [Dorcoceras hygrometricum] Length = 368 Score = 111 bits (278), Expect = 2e-26 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 314 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 368 >gb|KJB81028.1| hypothetical protein B456_013G125900 [Gossypium raimondii] Length = 373 Score = 111 bits (278), Expect = 2e-26 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 452 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 288 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 319 ARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 373