BLASTX nr result
ID: Astragalus22_contig00004836
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00004836 (558 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017972798.1| PREDICTED: uncharacterized protein LOC108661... 58 3e-08 gb|AGV54774.1| ankyrin repeat domain-containing protein [Phaseol... 59 3e-07 gb|OAY51819.1| hypothetical protein MANES_04G035400 [Manihot esc... 54 5e-07 ref|XP_015582537.1| PREDICTED: uncharacterized protein LOC107262... 52 4e-06 >ref|XP_017972798.1| PREDICTED: uncharacterized protein LOC108661332 [Theobroma cacao] Length = 41 Score = 57.8 bits (138), Expect = 3e-08 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 387 IFVVQNLRVFGPGLNPFSPYCLANHSLPAR 298 I + QNLRVFGPGLNPFSPYC+ANHSL +R Sbjct: 12 ILIFQNLRVFGPGLNPFSPYCIANHSLASR 41 >gb|AGV54774.1| ankyrin repeat domain-containing protein [Phaseolus vulgaris] Length = 226 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 396 MSPIFVVQNLRVFGPGLNPFSPYCLANHSLPAR 298 M+ IF NLRVFGPGLNPF+PYC+ANHSL AR Sbjct: 5 MNSIFAAHNLRVFGPGLNPFAPYCIANHSLRAR 37 >gb|OAY51819.1| hypothetical protein MANES_04G035400 [Manihot esculenta] Length = 42 Score = 54.3 bits (129), Expect = 5e-07 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -1 Query: 387 IFVVQNLRVFGPGLNPFSPYCLANHSLPAR 298 + + QNLRVFGPGLNPF+PYC+ANHS +R Sbjct: 13 VVIFQNLRVFGPGLNPFAPYCIANHSFASR 42 >ref|XP_015582537.1| PREDICTED: uncharacterized protein LOC107262265 [Ricinus communis] Length = 40 Score = 52.0 bits (123), Expect = 4e-06 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = -1 Query: 387 IFVVQNLRVFGPGLNPFSPYCLANHS 310 I + QNLRVFGPGLNPF+PYC+ANHS Sbjct: 13 ISISQNLRVFGPGLNPFAPYCIANHS 38