BLASTX nr result
ID: Astragalus22_contig00004146
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00004146 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU24329.1| hypothetical protein TSUD_49180 [Trifolium subte... 53 1e-06 dbj|GAU19492.1| hypothetical protein TSUD_77360 [Trifolium subte... 52 4e-06 ref|XP_003599253.1| PsAD1 [Medicago truncatula] >gi|357457949|re... 51 5e-06 ref|XP_003599252.1| hypothetical protein MTR_3g030790 [Medicago ... 51 5e-06 ref|XP_013465922.1| hypothetical protein MTR_1g016950 [Medicago ... 51 5e-06 >dbj|GAU24329.1| hypothetical protein TSUD_49180 [Trifolium subterraneum] Length = 69 Score = 52.8 bits (125), Expect = 1e-06 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +3 Query: 3 YISRGAFESNPQGYFSGLHSAGKAKR 80 YISRGAFESNPQGYFSGLHSAGK + Sbjct: 44 YISRGAFESNPQGYFSGLHSAGKGNK 69 >dbj|GAU19492.1| hypothetical protein TSUD_77360 [Trifolium subterraneum] Length = 69 Score = 51.6 bits (122), Expect = 4e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +3 Query: 3 YISRGAFESNPQGYFSGLHSAGKAKR 80 YISRGAFESNPQGYF+GLHSAGK + Sbjct: 44 YISRGAFESNPQGYFNGLHSAGKGNK 69 >ref|XP_003599253.1| PsAD1 [Medicago truncatula] ref|XP_003599255.1| PsAD1 [Medicago truncatula] gb|AES69504.1| PsAD1 [Medicago truncatula] gb|AES69506.1| PsAD1 [Medicago truncatula] Length = 65 Score = 51.2 bits (121), Expect = 5e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 141 MKAPGGGGSHISRQVFENNPKSYFADLRAGQ 233 MKAPGG GS+ISR+ FE NPK YFADL A Q Sbjct: 29 MKAPGGDGSNISREEFEKNPKGYFADLHAAQ 59 >ref|XP_003599252.1| hypothetical protein MTR_3g030790 [Medicago truncatula] ref|XP_003599254.1| hypothetical protein MTR_3g030810 [Medicago truncatula] gb|AES69503.1| hypothetical protein MTR_3g030790 [Medicago truncatula] gb|AES69505.1| hypothetical protein MTR_3g030810 [Medicago truncatula] Length = 65 Score = 51.2 bits (121), Expect = 5e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 141 MKAPGGGGSHISRQVFENNPKSYFADLRAGQ 233 MKAPGG GS+ISR+ FE NPK YFADL A Q Sbjct: 29 MKAPGGDGSNISREEFEKNPKGYFADLHAAQ 59 >ref|XP_013465922.1| hypothetical protein MTR_1g016950 [Medicago truncatula] gb|KEH39958.1| hypothetical protein MTR_1g016950 [Medicago truncatula] Length = 67 Score = 51.2 bits (121), Expect = 5e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 141 MKAPGGGGSHISRQVFENNPKSYFADLRAGQ 233 MKAPGG GS+ISR+ FE NPK YFADL A Q Sbjct: 31 MKAPGGDGSNISREQFEKNPKGYFADLHAAQ 61