BLASTX nr result
ID: Astragalus22_contig00003706
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00003706 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX61963.1| V-type proton ATPase subunit H-like protein, part... 93 2e-22 gb|KHN00570.1| Protein DA1-related 1 [Glycine soja] 101 2e-22 ref|XP_020983096.1| V-type proton ATPase subunit H isoform X2 [A... 97 3e-21 ref|XP_020983079.1| V-type proton ATPase subunit H isoform X1 [A... 97 3e-21 gb|ACJ85007.1| unknown [Medicago truncatula] >gi|388491592|gb|AF... 94 3e-20 ref|XP_003629515.2| vacuolar H+-ATPase subunit H, putative [Medi... 94 4e-20 gb|PNY15484.1| V-type proton ATPase subunit H-like protein, part... 93 6e-20 ref|XP_016184277.1| V-type proton ATPase subunit H [Arachis ipae... 94 6e-20 ref|XP_015948413.1| V-type proton ATPase subunit H isoform X3 [A... 94 6e-20 ref|XP_007156009.1| hypothetical protein PHAVU_003G250900g [Phas... 94 7e-20 dbj|GAY43262.1| hypothetical protein CUMW_073110 [Citrus unshiu] 87 9e-20 dbj|GAU12977.1| hypothetical protein TSUD_191690 [Trifolium subt... 93 9e-20 ref|XP_004509230.1| PREDICTED: V-type proton ATPase subunit H [C... 92 2e-19 ref|XP_017405700.1| PREDICTED: V-type proton ATPase subunit H [V... 91 4e-19 ref|XP_014509247.1| V-type proton ATPase subunit H [Vigna radiat... 91 6e-19 gb|KRH08325.1| hypothetical protein GLYMA_16G142600 [Glycine max] 91 8e-19 ref|XP_003548002.1| PREDICTED: V-type proton ATPase subunit H [G... 91 8e-19 gb|POE90857.1| v-type proton atpase subunit h [Quercus suber] 84 1e-18 ref|XP_020239298.1| V-type proton ATPase subunit H [Cajanus caja... 89 2e-18 ref|XP_019437622.1| PREDICTED: V-type proton ATPase subunit H-li... 89 2e-18 >gb|PNX61963.1| V-type proton ATPase subunit H-like protein, partial [Trifolium pratense] Length = 86 Score = 93.2 bits (230), Expect = 2e-22 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MDQAELTTDQVL+RDIPWETYMSTKLISGTSLQLLRRYDHRSES RA Sbjct: 1 MDQAELTTDQVLNRDIPWETYMSTKLISGTSLQLLRRYDHRSESQRA 47 >gb|KHN00570.1| Protein DA1-related 1 [Glycine soja] Length = 1212 Score = 101 bits (251), Expect = 2e-22 Identities = 50/62 (80%), Positives = 53/62 (85%) Frame = +3 Query: 168 SFSGELSEF*GFPTTMDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESH 347 +FS EL GFPT M QAELT++QVL RDIPWETYMSTKLISGTSLQLLRRYDHR ESH Sbjct: 576 NFSSELRPVLGFPTAMYQAELTSEQVLRRDIPWETYMSTKLISGTSLQLLRRYDHRPESH 635 Query: 348 RA 353 RA Sbjct: 636 RA 637 >ref|XP_020983096.1| V-type proton ATPase subunit H isoform X2 [Arachis duranensis] Length = 455 Score = 97.4 bits (241), Expect = 3e-21 Identities = 47/51 (92%), Positives = 47/51 (92%) Frame = +3 Query: 201 FPTTMDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 F T MD AELTTDQVL RDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA Sbjct: 44 FQTAMDHAELTTDQVLRRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 94 >ref|XP_020983079.1| V-type proton ATPase subunit H isoform X1 [Arachis duranensis] Length = 497 Score = 97.4 bits (241), Expect = 3e-21 Identities = 47/51 (92%), Positives = 47/51 (92%) Frame = +3 Query: 201 FPTTMDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 F T MD AELTTDQVL RDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA Sbjct: 44 FQTAMDHAELTTDQVLRRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 94 >gb|ACJ85007.1| unknown [Medicago truncatula] gb|AFK33862.1| unknown [Medicago truncatula] Length = 452 Score = 94.4 bits (233), Expect = 3e-20 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSES RA Sbjct: 1 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESQRA 47 >ref|XP_003629515.2| vacuolar H+-ATPase subunit H, putative [Medicago truncatula] gb|AET03991.2| vacuolar H+-ATPase subunit H, putative [Medicago truncatula] Length = 486 Score = 94.4 bits (233), Expect = 4e-20 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSES RA Sbjct: 1 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESQRA 47 >gb|PNY15484.1| V-type proton ATPase subunit H-like protein, partial [Trifolium pratense] Length = 395 Score = 93.2 bits (230), Expect = 6e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MDQAELTTDQVL+RDIPWETYMSTKLISGTSLQLLRRYDHRSES RA Sbjct: 1 MDQAELTTDQVLNRDIPWETYMSTKLISGTSLQLLRRYDHRSESQRA 47 >ref|XP_016184277.1| V-type proton ATPase subunit H [Arachis ipaensis] ref|XP_016184286.1| V-type proton ATPase subunit H [Arachis ipaensis] ref|XP_016184294.1| V-type proton ATPase subunit H [Arachis ipaensis] ref|XP_016184300.1| V-type proton ATPase subunit H [Arachis ipaensis] ref|XP_020973625.1| V-type proton ATPase subunit H [Arachis ipaensis] Length = 450 Score = 93.6 bits (231), Expect = 6e-20 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MD AELTTDQVL RDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA Sbjct: 1 MDHAELTTDQVLRRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 47 >ref|XP_015948413.1| V-type proton ATPase subunit H isoform X3 [Arachis duranensis] ref|XP_015948552.1| V-type proton ATPase subunit H isoform X3 [Arachis duranensis] ref|XP_020983166.1| V-type proton ATPase subunit H isoform X3 [Arachis duranensis] Length = 450 Score = 93.6 bits (231), Expect = 6e-20 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MD AELTTDQVL RDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA Sbjct: 1 MDHAELTTDQVLRRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 47 >ref|XP_007156009.1| hypothetical protein PHAVU_003G250900g [Phaseolus vulgaris] gb|ESW28003.1| hypothetical protein PHAVU_003G250900g [Phaseolus vulgaris] Length = 491 Score = 93.6 bits (231), Expect = 7e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MDQAELTT+QVLSRDIPWETYMSTKLIS TSLQLLRRYDHRSESHRA Sbjct: 1 MDQAELTTEQVLSRDIPWETYMSTKLISSTSLQLLRRYDHRSESHRA 47 >dbj|GAY43262.1| hypothetical protein CUMW_073110 [Citrus unshiu] Length = 111 Score = 87.0 bits (214), Expect = 9e-20 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MD AELTT+QVL RDIPWETYM+TKLISGT LQLLRRYD+RSESHRA Sbjct: 1 MDHAELTTEQVLKRDIPWETYMTTKLISGTGLQLLRRYDNRSESHRA 47 >dbj|GAU12977.1| hypothetical protein TSUD_191690 [Trifolium subterraneum] Length = 460 Score = 93.2 bits (230), Expect = 9e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MDQAELTTDQVL+RDIPWETYMSTKLISGTSLQLLRRYDHRSES RA Sbjct: 1 MDQAELTTDQVLTRDIPWETYMSTKLISGTSLQLLRRYDHRSESQRA 47 >ref|XP_004509230.1| PREDICTED: V-type proton ATPase subunit H [Cicer arietinum] Length = 452 Score = 92.4 bits (228), Expect = 2e-19 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MDQAELT++QVLSRDIPWETYMSTKLISGTSLQLLRRYDHR ESHRA Sbjct: 1 MDQAELTSEQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRPESHRA 47 >ref|XP_017405700.1| PREDICTED: V-type proton ATPase subunit H [Vigna angularis] Length = 388 Score = 90.9 bits (224), Expect = 4e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MDQAELTT+ VLSRDIPWETYMSTKLIS TSLQLLRRYDHRSESHRA Sbjct: 1 MDQAELTTELVLSRDIPWETYMSTKLISSTSLQLLRRYDHRSESHRA 47 >ref|XP_014509247.1| V-type proton ATPase subunit H [Vigna radiata var. radiata] Length = 452 Score = 90.9 bits (224), Expect = 6e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MDQAELTT+ VLSRDIPWETYMSTKLIS TSLQLLRRYDHRSESHRA Sbjct: 1 MDQAELTTELVLSRDIPWETYMSTKLISSTSLQLLRRYDHRSESHRA 47 >gb|KRH08325.1| hypothetical protein GLYMA_16G142600 [Glycine max] Length = 448 Score = 90.5 bits (223), Expect = 8e-19 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MDQAELT++QVL RDIPWETYMSTKLISGTSLQLLRRYDHR ESHRA Sbjct: 1 MDQAELTSEQVLRRDIPWETYMSTKLISGTSLQLLRRYDHRPESHRA 47 >ref|XP_003548002.1| PREDICTED: V-type proton ATPase subunit H [Glycine max] Length = 452 Score = 90.5 bits (223), Expect = 8e-19 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MDQAELT++QVL RDIPWETYMSTKLISGTSLQLLRRYDHR ESHRA Sbjct: 1 MDQAELTSEQVLRRDIPWETYMSTKLISGTSLQLLRRYDHRPESHRA 47 >gb|POE90857.1| v-type proton atpase subunit h [Quercus suber] Length = 111 Score = 84.3 bits (207), Expect = 1e-18 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MDQAEL T+QVL RDIPWETYM+TKLISGTSLQLLRRYD+R ES+RA Sbjct: 1 MDQAELNTEQVLKRDIPWETYMTTKLISGTSLQLLRRYDNRPESYRA 47 >ref|XP_020239298.1| V-type proton ATPase subunit H [Cajanus cajan] ref|XP_020239299.1| V-type proton ATPase subunit H [Cajanus cajan] Length = 452 Score = 89.4 bits (220), Expect = 2e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MDQAELT++QVL RDIPWETYMSTKLISGTSLQLLRRYDHR ESH+A Sbjct: 1 MDQAELTSEQVLRRDIPWETYMSTKLISGTSLQLLRRYDHRPESHKA 47 >ref|XP_019437622.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Lupinus angustifolius] Length = 452 Score = 89.4 bits (220), Expect = 2e-18 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +3 Query: 213 MDQAELTTDQVLSRDIPWETYMSTKLISGTSLQLLRRYDHRSESHRA 353 MD AELTTDQVL RDIPWETYM+TKLISGTSLQLLRRYDH+ ESHRA Sbjct: 1 MDHAELTTDQVLKRDIPWETYMATKLISGTSLQLLRRYDHQPESHRA 47