BLASTX nr result
ID: Astragalus22_contig00003674
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00003674 (593 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013444585.1| RNA-binding (RRM/RBD/RNP motif) family prote... 94 4e-20 ref|XP_003627533.2| RNA-binding (RRM/RBD/RNP motif) family prote... 94 4e-20 ref|XP_003627532.2| RNA-binding (RRM/RBD/RNP motif) family prote... 94 6e-20 ref|XP_015947941.1| serine/arginine-rich splicing factor RS31 is... 93 1e-19 ref|XP_022924570.1| serine/arginine-rich splicing factor RS31A-l... 94 2e-19 ref|XP_023527372.1| serine/arginine-rich splicing factor RS31-li... 96 2e-19 ref|XP_022924569.1| serine/arginine-rich splicing factor RS31-li... 94 2e-19 ref|XP_023527368.1| serine/arginine-rich splicing factor RS31-li... 96 2e-19 ref|XP_022924566.1| serine/arginine-rich splicing factor RS31-li... 94 2e-19 dbj|GAU47186.1| hypothetical protein TSUD_350510 [Trifolium subt... 93 3e-19 ref|XP_015937813.1| serine/arginine-rich splicing factor RS31 is... 92 4e-19 ref|XP_016181755.1| serine/arginine-rich splicing factor RS31 [A... 91 6e-19 ref|XP_014524133.1| serine/arginine-rich splicing factor RS31 [V... 92 6e-19 gb|AFK35236.1| unknown [Medicago truncatula] 91 6e-19 ref|XP_017405822.1| PREDICTED: serine/arginine-rich splicing fac... 92 6e-19 gb|KRH06430.1| hypothetical protein GLYMA_16G022300 [Glycine max] 91 1e-18 ref|XP_006598891.1| PREDICTED: serine/arginine-rich splicing fac... 91 1e-18 ref|XP_006598890.1| PREDICTED: serine/arginine-rich splicing fac... 91 2e-18 ref|XP_020990442.1| serine/arginine-rich splicing factor RS31 is... 90 2e-18 gb|ACJ84824.1| unknown, partial [Medicago truncatula] 89 6e-18 >ref|XP_013444585.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula] gb|KEH18610.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula] Length = 229 Score = 94.0 bits (232), Expect = 4e-20 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPDRRRSPDYGRNRSPDYGRNRSPDYGRNRS 457 DYGR RSPVYDRY GPDRRRSPDYGRNRSPDYGRNRSP+YGR RS Sbjct: 176 DYGRPRSPVYDRYTGPDRRRSPDYGRNRSPDYGRNRSPEYGRYRS 220 >ref|XP_003627533.2| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula] gb|AET02009.2| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula] Length = 235 Score = 94.0 bits (232), Expect = 4e-20 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPDRRRSPDYGRNRSPDYGRNRSPDYGRNRS 457 DYGR RSPVYDRY GPDRRRSPDYGRNRSPDYGRNRSP+YGR RS Sbjct: 182 DYGRPRSPVYDRYTGPDRRRSPDYGRNRSPDYGRNRSPEYGRYRS 226 >ref|XP_003627532.2| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula] gb|AFK41208.1| unknown [Medicago truncatula] gb|AET02008.2| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula] Length = 249 Score = 94.0 bits (232), Expect = 6e-20 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPDRRRSPDYGRNRSPDYGRNRSPDYGRNRS 457 DYGR RSPVYDRY GPDRRRSPDYGRNRSPDYGRNRSP+YGR RS Sbjct: 196 DYGRPRSPVYDRYTGPDRRRSPDYGRNRSPDYGRNRSPEYGRYRS 240 >ref|XP_015947941.1| serine/arginine-rich splicing factor RS31 isoform X1 [Arachis duranensis] ref|XP_015947942.1| serine/arginine-rich splicing factor RS31 isoform X1 [Arachis duranensis] Length = 255 Score = 93.2 bits (230), Expect = 1e-19 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPDRRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYG SPVYDRYNGPDRRRSPDYGR RSPDYGR+RSPDYGR+RS + G Sbjct: 194 DYGHPHSPVYDRYNGPDRRRSPDYGRQRSPDYGRHRSPDYGRHRSPDYG 242 >ref|XP_022924570.1| serine/arginine-rich splicing factor RS31A-like isoform X3 [Cucurbita moschata] Length = 307 Score = 94.0 bits (232), Expect = 2e-19 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGP-DRRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP YDRYNGP +RRRSPDYGRNRSPDYGRNRSP+ GRNRS EVG Sbjct: 181 DYGRARSPAYDRYNGPYERRRSPDYGRNRSPDYGRNRSPEVGRNRSPEVG 230 Score = 76.6 bits (187), Expect = 4e-13 Identities = 36/51 (70%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP R P+ R RSPDYGRNRSPDYGRNRSPDYG NRS + G Sbjct: 212 DYGRNRSPEVGRNRSPEVGRNRSPDYGRNRSPDYGRNRSPDYGSNRSPDYG 262 Score = 74.7 bits (182), Expect = 2e-12 Identities = 36/51 (70%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 + GR RSP Y R PD R RSPDYG NRSPDYGRNRSP+ GRNRS EVG Sbjct: 228 EVGRNRSPDYGRNRSPDYGRNRSPDYGSNRSPDYGRNRSPEVGRNRSPEVG 278 Score = 74.7 bits (182), Expect = 2e-12 Identities = 36/51 (70%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP Y R PD RSPDYGRNRSP+ GRNRSP+ GRNRS EVG Sbjct: 236 DYGRNRSPDYGRNRSPDYGSNRSPDYGRNRSPEVGRNRSPEVGRNRSPEVG 286 Score = 68.2 bits (165), Expect = 4e-10 Identities = 33/51 (64%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP Y PD R RSP+ GRNRSP+ GRNRSP+ GRNRS E G Sbjct: 244 DYGRNRSPDYGSNRSPDYGRNRSPEVGRNRSPEVGRNRSPEVGRNRSPEYG 294 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRS 457 DYG RSP Y R P+ R RSP+ GRNRSP+ GRNRSP+YG RS Sbjct: 252 DYGSNRSPDYGRNRSPEVGRNRSPEVGRNRSPEVGRNRSPEYGSVRS 298 >ref|XP_023527372.1| serine/arginine-rich splicing factor RS31-like isoform X2 [Cucurbita pepo subsp. pepo] Length = 440 Score = 95.5 bits (236), Expect = 2e-19 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGP-DRRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP YDRYNGP +RRRSPDYGRNRSPDYGRNRSPDYGRNRS + G Sbjct: 186 DYGRARSPAYDRYNGPYERRRSPDYGRNRSPDYGRNRSPDYGRNRSPDYG 235 Score = 80.1 bits (196), Expect = 5e-14 Identities = 37/51 (72%), Positives = 41/51 (80%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP Y R PD R RSPDYGRNRSP++GRNRSP++GRNRS EVG Sbjct: 209 DYGRNRSPDYGRNRSPDYGRNRSPDYGRNRSPEFGRNRSPEFGRNRSPEVG 259 Score = 75.5 bits (184), Expect = 2e-12 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP Y R PD R RSP++GRNRSP++GRNRSP+ GRNRS EVG Sbjct: 217 DYGRNRSPDYGRNRSPDYGRNRSPEFGRNRSPEFGRNRSPEVGRNRSPEVG 267 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/51 (60%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP Y R P+ R RSP++GRNRSP+ GRNRSP+ GR+RS +G Sbjct: 225 DYGRNRSPDYGRNRSPEFGRNRSPEFGRNRSPEVGRNRSPEVGRDRSPGIG 275 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/51 (56%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP + R P+ R RSP+ GRNRSP+ GR+RSP GR+RS +G Sbjct: 233 DYGRNRSPEFGRNRSPEFGRNRSPEVGRNRSPEVGRDRSPGIGRDRSPGIG 283 >ref|XP_022924569.1| serine/arginine-rich splicing factor RS31-like isoform X2 [Cucurbita moschata] Length = 312 Score = 94.0 bits (232), Expect = 2e-19 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGP-DRRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP YDRYNGP +RRRSPDYGRNRSPDYGRNRSP+ GRNRS EVG Sbjct: 186 DYGRARSPAYDRYNGPYERRRSPDYGRNRSPDYGRNRSPEVGRNRSPEVG 235 Score = 76.6 bits (187), Expect = 4e-13 Identities = 36/51 (70%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP R P+ R RSPDYGRNRSPDYGRNRSPDYG NRS + G Sbjct: 217 DYGRNRSPEVGRNRSPEVGRNRSPDYGRNRSPDYGRNRSPDYGSNRSPDYG 267 Score = 74.7 bits (182), Expect = 2e-12 Identities = 36/51 (70%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 + GR RSP Y R PD R RSPDYG NRSPDYGRNRSP+ GRNRS EVG Sbjct: 233 EVGRNRSPDYGRNRSPDYGRNRSPDYGSNRSPDYGRNRSPEVGRNRSPEVG 283 Score = 74.7 bits (182), Expect = 2e-12 Identities = 36/51 (70%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP Y R PD RSPDYGRNRSP+ GRNRSP+ GRNRS EVG Sbjct: 241 DYGRNRSPDYGRNRSPDYGSNRSPDYGRNRSPEVGRNRSPEVGRNRSPEVG 291 Score = 68.2 bits (165), Expect = 4e-10 Identities = 33/51 (64%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP Y PD R RSP+ GRNRSP+ GRNRSP+ GRNRS E G Sbjct: 249 DYGRNRSPDYGSNRSPDYGRNRSPEVGRNRSPEVGRNRSPEVGRNRSPEYG 299 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRS 457 DYG RSP Y R P+ R RSP+ GRNRSP+ GRNRSP+YG RS Sbjct: 257 DYGSNRSPDYGRNRSPEVGRNRSPEVGRNRSPEVGRNRSPEYGSVRS 303 >ref|XP_023527368.1| serine/arginine-rich splicing factor RS31-like isoform X1 [Cucurbita pepo subsp. pepo] ref|XP_023527369.1| serine/arginine-rich splicing factor RS31-like isoform X1 [Cucurbita pepo subsp. pepo] ref|XP_023527370.1| serine/arginine-rich splicing factor RS31-like isoform X1 [Cucurbita pepo subsp. pepo] Length = 459 Score = 95.5 bits (236), Expect = 2e-19 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGP-DRRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP YDRYNGP +RRRSPDYGRNRSPDYGRNRSPDYGRNRS + G Sbjct: 205 DYGRARSPAYDRYNGPYERRRSPDYGRNRSPDYGRNRSPDYGRNRSPDYG 254 Score = 80.1 bits (196), Expect = 5e-14 Identities = 37/51 (72%), Positives = 41/51 (80%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP Y R PD R RSPDYGRNRSP++GRNRSP++GRNRS EVG Sbjct: 228 DYGRNRSPDYGRNRSPDYGRNRSPDYGRNRSPEFGRNRSPEFGRNRSPEVG 278 Score = 75.5 bits (184), Expect = 2e-12 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP Y R PD R RSP++GRNRSP++GRNRSP+ GRNRS EVG Sbjct: 236 DYGRNRSPDYGRNRSPDYGRNRSPEFGRNRSPEFGRNRSPEVGRNRSPEVG 286 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/51 (60%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP Y R P+ R RSP++GRNRSP+ GRNRSP+ GR+RS +G Sbjct: 244 DYGRNRSPDYGRNRSPEFGRNRSPEFGRNRSPEVGRNRSPEVGRDRSPGIG 294 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/51 (56%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP + R P+ R RSP+ GRNRSP+ GR+RSP GR+RS +G Sbjct: 252 DYGRNRSPEFGRNRSPEFGRNRSPEVGRNRSPEVGRDRSPGIGRDRSPGIG 302 >ref|XP_022924566.1| serine/arginine-rich splicing factor RS31-like isoform X1 [Cucurbita moschata] ref|XP_022924567.1| serine/arginine-rich splicing factor RS31-like isoform X1 [Cucurbita moschata] ref|XP_022924568.1| serine/arginine-rich splicing factor RS31-like isoform X1 [Cucurbita moschata] Length = 331 Score = 94.0 bits (232), Expect = 2e-19 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGP-DRRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP YDRYNGP +RRRSPDYGRNRSPDYGRNRSP+ GRNRS EVG Sbjct: 205 DYGRARSPAYDRYNGPYERRRSPDYGRNRSPDYGRNRSPEVGRNRSPEVG 254 Score = 76.6 bits (187), Expect = 5e-13 Identities = 36/51 (70%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP R P+ R RSPDYGRNRSPDYGRNRSPDYG NRS + G Sbjct: 236 DYGRNRSPEVGRNRSPEVGRNRSPDYGRNRSPDYGRNRSPDYGSNRSPDYG 286 Score = 74.7 bits (182), Expect = 2e-12 Identities = 36/51 (70%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 + GR RSP Y R PD R RSPDYG NRSPDYGRNRSP+ GRNRS EVG Sbjct: 252 EVGRNRSPDYGRNRSPDYGRNRSPDYGSNRSPDYGRNRSPEVGRNRSPEVG 302 Score = 74.7 bits (182), Expect = 2e-12 Identities = 36/51 (70%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP Y R PD RSPDYGRNRSP+ GRNRSP+ GRNRS EVG Sbjct: 260 DYGRNRSPDYGRNRSPDYGSNRSPDYGRNRSPEVGRNRSPEVGRNRSPEVG 310 Score = 68.2 bits (165), Expect = 5e-10 Identities = 33/51 (64%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP Y PD R RSP+ GRNRSP+ GRNRSP+ GRNRS E G Sbjct: 268 DYGRNRSPDYGSNRSPDYGRNRSPEVGRNRSPEVGRNRSPEVGRNRSPEYG 318 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRS 457 DYG RSP Y R P+ R RSP+ GRNRSP+ GRNRSP+YG RS Sbjct: 276 DYGSNRSPDYGRNRSPEVGRNRSPEVGRNRSPEVGRNRSPEYGSVRS 322 >dbj|GAU47186.1| hypothetical protein TSUD_350510 [Trifolium subterraneum] Length = 291 Score = 92.8 bits (229), Expect = 3e-19 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPDRRRSPDYGRNRSPDYGRNRSPDYGRNRS 457 DYGR RSP YDRY+GPDRRRSPDYGRNRSPDYGRNRSP+YGR RS Sbjct: 238 DYGRPRSPAYDRYSGPDRRRSPDYGRNRSPDYGRNRSPEYGRYRS 282 >ref|XP_015937813.1| serine/arginine-rich splicing factor RS31 isoform X1 [Arachis duranensis] ref|XP_015937814.1| serine/arginine-rich splicing factor RS31 isoform X2 [Arachis duranensis] Length = 247 Score = 91.7 bits (226), Expect = 4e-19 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPDRRRSPDYGRNRSPDYGRNRSPDYGRNRS 457 DYG RSPVYDRYNGPDRRRSPDYGR RSPDYGR+RSPDYGR RS Sbjct: 194 DYGHPRSPVYDRYNGPDRRRSPDYGRQRSPDYGRHRSPDYGRYRS 238 >ref|XP_016181755.1| serine/arginine-rich splicing factor RS31 [Arachis ipaensis] ref|XP_016181763.1| serine/arginine-rich splicing factor RS31 [Arachis ipaensis] Length = 247 Score = 91.3 bits (225), Expect = 6e-19 Identities = 40/45 (88%), Positives = 40/45 (88%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPDRRRSPDYGRNRSPDYGRNRSPDYGRNRS 457 DYG RSPVYDRYNGPDRRRSPDYGR RSPDYGR RSPDYGR RS Sbjct: 194 DYGHPRSPVYDRYNGPDRRRSPDYGRQRSPDYGRQRSPDYGRYRS 238 >ref|XP_014524133.1| serine/arginine-rich splicing factor RS31 [Vigna radiata var. radiata] Length = 288 Score = 92.0 bits (227), Expect = 6e-19 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = -3 Query: 591 DYGRQRSPVYDRYNG-PDRRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSPVYDRYNG PDRRRSPDYGR+RSPDYGR RSPDYGR RS + G Sbjct: 194 DYGRPRSPVYDRYNGGPDRRRSPDYGRHRSPDYGRRRSPDYGRRRSPDYG 243 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRS 457 DYGR+RSP Y + PD + RSPD+ + RSPD+G+ RSP+YGR RS Sbjct: 233 DYGRRRSPDYGKPRSPDYVKPRSPDFVKPRSPDFGKPRSPEYGRYRS 279 >gb|AFK35236.1| unknown [Medicago truncatula] Length = 249 Score = 91.3 bits (225), Expect = 6e-19 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPDRRRSPDYGRNRSPDYGRNRSPDYGRNRS 457 DYGR RSPVYDRY GPDRRRSPDYGRN SPDYGRNRSP+YGR RS Sbjct: 196 DYGRPRSPVYDRYTGPDRRRSPDYGRNGSPDYGRNRSPEYGRYRS 240 >ref|XP_017405822.1| PREDICTED: serine/arginine-rich splicing factor RS31 [Vigna angularis] gb|KOM25730.1| hypothetical protein LR48_Vigan181s000800 [Vigna angularis] Length = 312 Score = 92.4 bits (228), Expect = 6e-19 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = -3 Query: 591 DYGRQRSPVYDRYNG-PDRRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSPVYDRYNG PDRRRSPDYGR+RSPDYGR+RSPDYGR RS + G Sbjct: 194 DYGRPRSPVYDRYNGGPDRRRSPDYGRHRSPDYGRHRSPDYGRRRSPDYG 243 Score = 70.5 bits (171), Expect = 6e-11 Identities = 33/49 (67%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSE 451 DYGR RSP Y R+ PD RRRSPDYGR RSPDYG+ RSPDY + RS + Sbjct: 217 DYGRHRSPDYGRHRSPDYGRRRSPDYGRRRSPDYGKPRSPDYVKPRSPD 265 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/51 (62%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSP Y R PD RRRSPDYG+ RSPDY + RSPDY + RS + G Sbjct: 225 DYGRHRSPDYGRRRSPDYGRRRSPDYGKPRSPDYVKPRSPDYVKPRSPDFG 275 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/51 (54%), Positives = 37/51 (72%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPD--RRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYG+ RSP Y + PD + RSPD+G+ RSPD+G+ RSPD+G+ RS E G Sbjct: 249 DYGKPRSPDYVKPRSPDYVKPRSPDFGKPRSPDFGKPRSPDFGKPRSPEYG 299 >gb|KRH06430.1| hypothetical protein GLYMA_16G022300 [Glycine max] Length = 246 Score = 90.5 bits (223), Expect = 1e-18 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNG--PDRRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSPVYDRYNG PDRRRSPDYGR+RSPDYGR RSPDYGR +S + G Sbjct: 175 DYGRPRSPVYDRYNGGGPDRRRSPDYGRHRSPDYGRRRSPDYGRRKSPDYG 225 >ref|XP_006598891.1| PREDICTED: serine/arginine-rich splicing factor RS31 isoform X2 [Glycine max] gb|KRH06427.1| hypothetical protein GLYMA_16G022300 [Glycine max] gb|KRH06428.1| hypothetical protein GLYMA_16G022300 [Glycine max] gb|KRH06429.1| hypothetical protein GLYMA_16G022300 [Glycine max] Length = 261 Score = 90.5 bits (223), Expect = 1e-18 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNG--PDRRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSPVYDRYNG PDRRRSPDYGR+RSPDYGR RSPDYGR +S + G Sbjct: 190 DYGRPRSPVYDRYNGGGPDRRRSPDYGRHRSPDYGRRRSPDYGRRKSPDYG 240 >ref|XP_006598890.1| PREDICTED: serine/arginine-rich splicing factor RS31 isoform X1 [Glycine max] gb|KHN15911.1| Arginine/serine-rich-splicing factor RSP31 [Glycine soja] gb|KRH06424.1| hypothetical protein GLYMA_16G022300 [Glycine max] gb|KRH06425.1| hypothetical protein GLYMA_16G022300 [Glycine max] gb|KRH06426.1| hypothetical protein GLYMA_16G022300 [Glycine max] Length = 264 Score = 90.5 bits (223), Expect = 2e-18 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 2/51 (3%) Frame = -3 Query: 591 DYGRQRSPVYDRYNG--PDRRRSPDYGRNRSPDYGRNRSPDYGRNRSSEVG 445 DYGR RSPVYDRYNG PDRRRSPDYGR+RSPDYGR RSPDYGR +S + G Sbjct: 193 DYGRPRSPVYDRYNGGGPDRRRSPDYGRHRSPDYGRRRSPDYGRRKSPDYG 243 >ref|XP_020990442.1| serine/arginine-rich splicing factor RS31 isoform X2 [Arachis duranensis] Length = 247 Score = 89.7 bits (221), Expect = 2e-18 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPDRRRSPDYGRNRSPDYGRNRSPDYGRNRS 457 DYG SPVYDRYNGPDRRRSPDYGR RSPDYGR+RSPDYGR RS Sbjct: 194 DYGHPHSPVYDRYNGPDRRRSPDYGRQRSPDYGRHRSPDYGRYRS 238 >gb|ACJ84824.1| unknown, partial [Medicago truncatula] Length = 242 Score = 88.6 bits (218), Expect = 6e-18 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -3 Query: 591 DYGRQRSPVYDRYNGPDRRRSPDYGRNRSPDYGRNRSPDYGR 466 DYGR RSPVYDRY GPDRRRSPDYGRN SPDYGRNRSP+YGR Sbjct: 196 DYGRPRSPVYDRYTGPDRRRSPDYGRNGSPDYGRNRSPEYGR 237