BLASTX nr result
ID: Astragalus22_contig00003133
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00003133 (389 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZM85530.1| hypothetical protein DCAR_027048 [Daucus carota s... 53 5e-06 >gb|KZM85530.1| hypothetical protein DCAR_027048 [Daucus carota subsp. sativus] Length = 163 Score = 53.1 bits (126), Expect = 5e-06 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = +3 Query: 243 ISIVLLTKFIYLEIYEYFLFP*FQNMFLGGTDTTSTTVEWAMAELLKNP 389 IS+ L T++I ++ + +Q MFLGGTDT+ST++EWAM ELL NP Sbjct: 53 ISLCLATRWILIQKFPPNFVRLWQEMFLGGTDTSSTSIEWAMCELLPNP 101