BLASTX nr result
ID: Astragalus22_contig00002341
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00002341 (727 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADX30685.1| low-temperature inducible protein [Caragana jubata] 76 5e-14 >gb|ADX30685.1| low-temperature inducible protein [Caragana jubata] Length = 116 Score = 76.3 bits (186), Expect = 5e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 271 FWSLILPLVVLLTFTSVEGARNLQQSTLSKVHEVSKID 384 FWSLILPLVVLLTFTSVEGARNLQQSTLSKVHEVSKID Sbjct: 6 FWSLILPLVVLLTFTSVEGARNLQQSTLSKVHEVSKID 43