BLASTX nr result
ID: Astragalus22_contig00000963
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00000963 (430 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004513771.1| PREDICTED: translation factor GUF1 homolog, ... 57 2e-06 >ref|XP_004513771.1| PREDICTED: translation factor GUF1 homolog, chloroplastic [Cicer arietinum] ref|XP_004513772.1| PREDICTED: translation factor GUF1 homolog, chloroplastic [Cicer arietinum] Length = 672 Score = 56.6 bits (135), Expect = 2e-06 Identities = 34/48 (70%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = +1 Query: 289 MEKMALTIQNPLFFSNSTTLPKT-SSPLFSANRNHLFALPLSYSKSPL 429 MEKMALT QN FF+ +TTLPKT SSPLF + RN FALPLS SKS L Sbjct: 1 MEKMALTFQNSSFFT-TTTLPKTSSSPLFFSKRNKRFALPLSSSKSLL 47