BLASTX nr result
ID: Astragalus22_contig00000790
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00000790 (680 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004494358.1| PREDICTED: dephospho-CoA kinase [Cicer ariet... 59 7e-07 dbj|GAU11202.1| hypothetical protein TSUD_341920 [Trifolium subt... 58 2e-06 >ref|XP_004494358.1| PREDICTED: dephospho-CoA kinase [Cicer arietinum] ref|XP_012569485.1| PREDICTED: dephospho-CoA kinase [Cicer arietinum] Length = 234 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 680 WYEFWLSRQGVLIILTSLTSGAVVCLKALNNYSS 579 WYEFWLSRQGVLI L SLTSG ++C+K+ NN SS Sbjct: 201 WYEFWLSRQGVLITLASLTSGVILCMKSFNNNSS 234 >dbj|GAU11202.1| hypothetical protein TSUD_341920 [Trifolium subterraneum] Length = 234 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 680 WYEFWLSRQGVLIILTSLTSGAVVCLKALNNYSS 579 WYEFW SRQGV IIL SLTSG V+C+KA NN SS Sbjct: 201 WYEFWRSRQGVSIILASLTSGVVLCMKAFNNNSS 234