BLASTX nr result
ID: Astragalus22_contig00000601
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00000601 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616097.1| cystathionine beta-synthase (CBS) family pro... 75 2e-13 ref|XP_004490742.1| PREDICTED: CBS domain-containing protein CBS... 72 7e-13 ref|XP_003616098.2| cystathionine beta-synthase (CBS) family pro... 71 2e-12 dbj|GAU51181.1| hypothetical protein TSUD_246580, partial [Trifo... 69 5e-12 ref|XP_004490743.1| PREDICTED: CBS domain-containing protein CBS... 69 2e-11 gb|PNY01442.1| CBS domain protein [Trifolium pratense] 69 2e-11 ref|XP_019461827.1| PREDICTED: CBS domain-containing protein CBS... 67 5e-11 ref|XP_019461826.1| PREDICTED: CBS domain-containing protein CBS... 67 9e-11 ref|XP_014505363.1| CBS domain-containing protein CBSX3, mitocho... 67 1e-10 ref|XP_007141991.1| hypothetical protein PHAVU_008G243300g [Phas... 66 2e-10 gb|AGV54690.1| Cbs domain protein [Phaseolus vulgaris] 66 2e-10 ref|XP_003616089.2| PPR containing plant protein [Medicago trunc... 67 3e-10 ref|XP_020213240.1| CBS domain-containing protein CBSX3, mitocho... 65 5e-10 ref|XP_013451869.1| cystathionine beta-synthase (CBS) family pro... 62 9e-10 ref|XP_020213241.1| CBS domain-containing protein CBSX3, mitocho... 62 7e-09 ref|XP_021806876.1| CBS domain-containing protein CBSX3, mitocho... 61 1e-08 ref|XP_008246548.1| PREDICTED: CBS domain-containing protein CBS... 61 1e-08 ref|XP_007207482.1| CBS domain-containing protein CBSX3, mitocho... 61 1e-08 gb|KRH17238.1| hypothetical protein GLYMA_14G207600 [Glycine max... 60 1e-08 ref|NP_001237662.2| CBS domain-containing protein [Glycine max] ... 61 1e-08 >ref|XP_003616097.1| cystathionine beta-synthase (CBS) family protein [Medicago truncatula] gb|AES99055.1| cystathionine beta-synthase (CBS) family protein [Medicago truncatula] Length = 254 Score = 74.7 bits (182), Expect = 2e-13 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -3 Query: 224 LNQTVKMQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 L+ + KMQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQP AFS Sbjct: 44 LSLSAKMQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPVAFS 85 Score = 65.5 bits (158), Expect = 5e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQP AFSRFES TPARIEEHGFESTTISDIL+GK Sbjct: 79 LQPVAFSRFESATPARIEEHGFESTTISDILKGK 112 >ref|XP_004490742.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial isoform X1 [Cicer arietinum] Length = 211 Score = 72.4 bits (176), Expect = 7e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -3 Query: 215 TVKMQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 T KMQGGLRSFLSNGN+IKNAVLQRVRMV PLLQP AFS Sbjct: 4 TAKMQGGLRSFLSNGNIIKNAVLQRVRMVTPLLQPAAFS 42 Score = 66.6 bits (161), Expect = 1e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQP AFSRFESVTPARIEEHGFES TISDILQGK Sbjct: 36 LQPAAFSRFESVTPARIEEHGFESATISDILQGK 69 >ref|XP_003616098.2| cystathionine beta-synthase (CBS) family protein [Medicago truncatula] gb|ACJ84966.1| unknown [Medicago truncatula] gb|AFK49539.1| unknown [Medicago truncatula] gb|AES99056.2| cystathionine beta-synthase (CBS) family protein [Medicago truncatula] Length = 205 Score = 71.2 bits (173), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 206 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQP AFS Sbjct: 1 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPVAFS 36 Score = 65.5 bits (158), Expect = 3e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQP AFSRFES TPARIEEHGFESTTISDIL+GK Sbjct: 30 LQPVAFSRFESATPARIEEHGFESTTISDILKGK 63 >dbj|GAU51181.1| hypothetical protein TSUD_246580, partial [Trifolium subterraneum] Length = 138 Score = 68.6 bits (166), Expect = 5e-12 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQP AFSRFESVTPARIEEHGFESTTISDILQGK Sbjct: 30 LQPAAFSRFESVTPARIEEHGFESTTISDILQGK 63 Score = 67.4 bits (163), Expect = 1e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 206 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 MQG LRSFLSNGNVIKNAVLQRVR+VNPLLQP AFS Sbjct: 1 MQGALRSFLSNGNVIKNAVLQRVRVVNPLLQPAAFS 36 >ref|XP_004490743.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial isoform X2 [Cicer arietinum] ref|XP_012568486.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial isoform X2 [Cicer arietinum] Length = 205 Score = 68.6 bits (166), Expect = 2e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 206 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 MQGGLRSFLSNGN+IKNAVLQRVRMV PLLQP AFS Sbjct: 1 MQGGLRSFLSNGNIIKNAVLQRVRMVTPLLQPAAFS 36 Score = 66.6 bits (161), Expect = 1e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQP AFSRFESVTPARIEEHGFES TISDILQGK Sbjct: 30 LQPAAFSRFESVTPARIEEHGFESATISDILQGK 63 >gb|PNY01442.1| CBS domain protein [Trifolium pratense] Length = 205 Score = 68.6 bits (166), Expect = 2e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQP AFSRFESVTPARIEEHGFESTTISDILQGK Sbjct: 30 LQPAAFSRFESVTPARIEEHGFESTTISDILQGK 63 Score = 65.5 bits (158), Expect = 3e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 206 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 MQG LRSFLSNG+VIKNAVLQRVR+VNPLLQP AFS Sbjct: 1 MQGALRSFLSNGSVIKNAVLQRVRVVNPLLQPAAFS 36 >ref|XP_019461827.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like isoform X2 [Lupinus angustifolius] ref|XP_019461828.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like isoform X2 [Lupinus angustifolius] gb|OIW02618.1| hypothetical protein TanjilG_24069 [Lupinus angustifolius] Length = 206 Score = 67.4 bits (163), Expect = 5e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQP AFSRFESVTPARIEEHGFESTTI+DILQGK Sbjct: 30 LQPVAFSRFESVTPARIEEHGFESTTIADILQGK 63 Score = 60.5 bits (145), Expect = 2e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 206 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 M GGLR FLS+GNVIK AVLQ+VRMVNPLLQP AFS Sbjct: 1 MLGGLRVFLSHGNVIKTAVLQQVRMVNPLLQPVAFS 36 >ref|XP_019461826.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like isoform X1 [Lupinus angustifolius] Length = 241 Score = 67.4 bits (163), Expect = 9e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQP AFSRFESVTPARIEEHGFESTTI+DILQGK Sbjct: 65 LQPVAFSRFESVTPARIEEHGFESTTIADILQGK 98 Score = 64.3 bits (155), Expect = 1e-09 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 215 TVKMQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 +VKM GGLR FLS+GNVIK AVLQ+VRMVNPLLQP AFS Sbjct: 33 SVKMLGGLRVFLSHGNVIKTAVLQQVRMVNPLLQPVAFS 71 >ref|XP_014505363.1| CBS domain-containing protein CBSX3, mitochondrial [Vigna radiata var. radiata] ref|XP_014505364.1| CBS domain-containing protein CBSX3, mitochondrial [Vigna radiata var. radiata] ref|XP_017428003.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial [Vigna angularis] ref|XP_017428006.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial [Vigna angularis] ref|XP_017428007.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial [Vigna angularis] ref|XP_017428008.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial [Vigna angularis] gb|KOM47121.1| hypothetical protein LR48_Vigan07g082500 [Vigna angularis] dbj|BAT81332.1| hypothetical protein VIGAN_03102800 [Vigna angularis var. angularis] Length = 205 Score = 66.6 bits (161), Expect = 1e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 206 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 MQGGLR+FLSNGNVIKNAVLQRVRMVNPLLQP A S Sbjct: 1 MQGGLRTFLSNGNVIKNAVLQRVRMVNPLLQPIASS 36 Score = 58.9 bits (141), Expect = 8e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQP A SRFESVTPARIEEHGFESTTI+DI++ K Sbjct: 30 LQPIASSRFESVTPARIEEHGFESTTIADIMKDK 63 >ref|XP_007141991.1| hypothetical protein PHAVU_008G243300g [Phaseolus vulgaris] gb|ESW13985.1| hypothetical protein PHAVU_008G243300g [Phaseolus vulgaris] Length = 205 Score = 65.9 bits (159), Expect = 2e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 206 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 MQGGLRSFLS+GNVIKNAVLQRVRMVNPLLQP A S Sbjct: 1 MQGGLRSFLSHGNVIKNAVLQRVRMVNPLLQPIASS 36 Score = 58.9 bits (141), Expect = 8e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQP A SRFESVTPARIEEHGFESTTI+DI++ K Sbjct: 30 LQPIASSRFESVTPARIEEHGFESTTIADIMKDK 63 >gb|AGV54690.1| Cbs domain protein [Phaseolus vulgaris] Length = 206 Score = 65.9 bits (159), Expect = 2e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 206 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 MQGGLRSFLS+GNVIKNAVLQRVRMVNPLLQP A S Sbjct: 1 MQGGLRSFLSHGNVIKNAVLQRVRMVNPLLQPIASS 36 Score = 58.9 bits (141), Expect = 8e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQP A SRFESVTPARIEEHGFESTTI+DI++ K Sbjct: 30 LQPIASSRFESVTPARIEEHGFESTTIADIMKDK 63 >ref|XP_003616089.2| PPR containing plant protein [Medicago truncatula] gb|AES99047.2| PPR containing plant protein [Medicago truncatula] Length = 567 Score = 67.0 bits (162), Expect = 3e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQP AFSRFES TPARIEEHGFESTTISDILQGK Sbjct: 30 LQPVAFSRFESATPARIEEHGFESTTISDILQGK 63 Score = 63.2 bits (152), Expect = 7e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 206 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 MQGGLRSFLS+ NVIKNAVLQRV MVNPLLQP AFS Sbjct: 1 MQGGLRSFLSDRNVIKNAVLQRVCMVNPLLQPVAFS 36 >ref|XP_020213240.1| CBS domain-containing protein CBSX3, mitochondrial isoform X1 [Cajanus cajan] Length = 260 Score = 65.5 bits (158), Expect = 5e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 215 TVKMQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 T KMQGGLRSFLS+GNVIKNAVLQRVRMVNP++Q A S Sbjct: 53 TAKMQGGLRSFLSHGNVIKNAVLQRVRMVNPMMQSVASS 91 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 +Q A SRFESVTPARIEEHGFESTTI+DIL+ K Sbjct: 85 MQSVASSRFESVTPARIEEHGFESTTIADILKDK 118 >ref|XP_013451869.1| cystathionine beta-synthase (CBS) family protein [Medicago truncatula] gb|KEH25897.1| cystathionine beta-synthase (CBS) family protein [Medicago truncatula] Length = 111 Score = 62.0 bits (149), Expect = 9e-10 Identities = 31/49 (63%), Positives = 34/49 (69%) Frame = -3 Query: 206 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFSLARYLKLWCSQNH 60 MQGGLRSFLSN VI+N LQRVR VNPLLQP +FS Y C + H Sbjct: 1 MQGGLRSFLSNEKVIQNVFLQRVRTVNPLLQPVSFSQFEYATPACIEEH 49 Score = 58.9 bits (141), Expect = 1e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQP +FS+FE TPA IEEHGFESTTISDILQGK Sbjct: 30 LQPVSFSQFEYATPACIEEHGFESTTISDILQGK 63 >ref|XP_020213241.1| CBS domain-containing protein CBSX3, mitochondrial isoform X2 [Cajanus cajan] ref|XP_020213242.1| CBS domain-containing protein CBSX3, mitochondrial isoform X2 [Cajanus cajan] gb|KYP71566.1| hypothetical protein KK1_010831 [Cajanus cajan] Length = 205 Score = 61.6 bits (148), Expect = 7e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 206 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 MQGGLRSFLS+GNVIKNAVLQRVRMVNP++Q A S Sbjct: 1 MQGGLRSFLSHGNVIKNAVLQRVRMVNPMMQSVASS 36 Score = 56.2 bits (134), Expect = 8e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 +Q A SRFESVTPARIEEHGFESTTI+DIL+ K Sbjct: 30 MQSVASSRFESVTPARIEEHGFESTTIADILKDK 63 >ref|XP_021806876.1| CBS domain-containing protein CBSX3, mitochondrial [Prunus avium] ref|XP_021806877.1| CBS domain-containing protein CBSX3, mitochondrial [Prunus avium] Length = 205 Score = 61.2 bits (147), Expect = 1e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 +QP AFSRFES TPARIEEHGFEST I+DIL+GK Sbjct: 30 IQPVAFSRFESATPARIEEHGFESTRIADILKGK 63 >ref|XP_008246548.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial [Prunus mume] ref|XP_008246556.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial [Prunus mume] Length = 205 Score = 61.2 bits (147), Expect = 1e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 +QP AFSRFES TPARIEEHGFEST I+DIL+GK Sbjct: 30 IQPVAFSRFESATPARIEEHGFESTRIADILRGK 63 >ref|XP_007207482.1| CBS domain-containing protein CBSX3, mitochondrial [Prunus persica] ref|XP_020422443.1| CBS domain-containing protein CBSX3, mitochondrial [Prunus persica] gb|ONH99580.1| hypothetical protein PRUPE_6G037200 [Prunus persica] Length = 205 Score = 61.2 bits (147), Expect = 1e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 +QP AFSRFES TPARIEEHGFEST I+DIL+GK Sbjct: 30 IQPVAFSRFESATPARIEEHGFESTRIADILKGK 63 >gb|KRH17238.1| hypothetical protein GLYMA_14G207600 [Glycine max] gb|KRH17239.1| hypothetical protein GLYMA_14G207600 [Glycine max] Length = 160 Score = 60.1 bits (144), Expect = 1e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 206 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 MQGG +SFLS+GNVI+NAVLQRVRMVNPLLQP S Sbjct: 1 MQGGFQSFLSHGNVIRNAVLQRVRMVNPLLQPIVSS 36 Score = 58.9 bits (141), Expect = 4e-08 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQP SRFESVTPARIEEHGFESTTISDIL K Sbjct: 30 LQPIVSSRFESVTPARIEEHGFESTTISDILNDK 63 >ref|NP_001237662.2| CBS domain-containing protein [Glycine max] ref|XP_006574340.1| PREDICTED: uncharacterized protein LOC100306364 isoform X1 [Glycine max] gb|KHN41012.1| CBS domain-containing protein CBSX3, mitochondrial [Glycine soja] gb|KRH72884.1| hypothetical protein GLYMA_02G238700 [Glycine max] gb|KRH72885.1| hypothetical protein GLYMA_02G238700 [Glycine max] gb|KRH72886.1| hypothetical protein GLYMA_02G238700 [Glycine max] gb|KRH72887.1| hypothetical protein GLYMA_02G238700 [Glycine max] Length = 205 Score = 60.8 bits (146), Expect = 1e-08 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 206 MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPTAFS 99 MQGG+RSFLS+GNVI+NAVLQRVRMVNPLLQ A S Sbjct: 1 MQGGMRSFLSHGNVIRNAVLQRVRMVNPLLQTIASS 36 Score = 57.4 bits (137), Expect = 3e-07 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = +2 Query: 2 LQPTAFSRFESVTPARIEEHGFESTTISDILQGK 103 LQ A SRFESVTPARIEEHGFESTTISDIL K Sbjct: 30 LQTIASSRFESVTPARIEEHGFESTTISDILNDK 63