BLASTX nr result
ID: Astragalus22_contig00000075
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00000075 (612 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012573648.1| PREDICTED: ethylene-responsive transcription... 64 2e-08 dbj|GAU24537.1| hypothetical protein TSUD_156500 [Trifolium subt... 57 3e-06 gb|AFK37997.1| unknown [Medicago truncatula] 57 5e-06 ref|XP_003608663.1| ethylene response factor [Medicago truncatul... 57 5e-06 gb|ACJ84902.1| unknown [Medicago truncatula] 52 6e-06 >ref|XP_012573648.1| PREDICTED: ethylene-responsive transcription factor 5-like [Cicer arietinum] Length = 317 Score = 63.5 bits (153), Expect = 2e-08 Identities = 34/69 (49%), Positives = 37/69 (53%), Gaps = 4/69 (5%) Frame = -3 Query: 610 FPLEVT----AVPETSNXXXXXXXXXXXXXXXXXXXXXXXXXEFDVSCFKEMPLTPSTWT 443 FPLEV AV ETS EFDV+CFK+MPLTPSTWT Sbjct: 228 FPLEVNEVIAAVEETSGDGERKRCREEEEVEEKPVVKKEKTMEFDVNCFKDMPLTPSTWT 287 Query: 442 GFWDGDVKG 416 GFWDGD+KG Sbjct: 288 GFWDGDIKG 296 >dbj|GAU24537.1| hypothetical protein TSUD_156500 [Trifolium subterraneum] Length = 279 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -3 Query: 493 FDVSCFKEMPLTPSTWTGFWDGDVKG 416 FDV+CFKE+PLTPS WTGFWD DVKG Sbjct: 238 FDVNCFKEIPLTPSAWTGFWDNDVKG 263 >gb|AFK37997.1| unknown [Medicago truncatula] Length = 307 Score = 56.6 bits (135), Expect = 5e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -3 Query: 493 FDVSCFKEMPLTPSTWTGFWDGDVKG 416 +D+SCFKEMPLTPS WTG WDGDVKG Sbjct: 261 YDMSCFKEMPLTPSFWTGLWDGDVKG 286 >ref|XP_003608663.1| ethylene response factor [Medicago truncatula] gb|AES90860.1| ethylene response factor [Medicago truncatula] Length = 307 Score = 56.6 bits (135), Expect = 5e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -3 Query: 493 FDVSCFKEMPLTPSTWTGFWDGDVKG 416 +D+SCFKEMPLTPS WTG WDGDVKG Sbjct: 261 YDMSCFKEMPLTPSFWTGLWDGDVKG 286 >gb|ACJ84902.1| unknown [Medicago truncatula] Length = 45 Score = 52.0 bits (123), Expect = 6e-06 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -3 Query: 487 VSCFKEMPLTPSTWTGFWDGDVKG 416 ++CFKEMPLTPS WTG WDGDVKG Sbjct: 1 MNCFKEMPLTPSFWTGLWDGDVKG 24