BLASTX nr result
ID: Astragalus22_contig00000023
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00000023 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013457923.1| PPR containing plant-like protein [Medicago ... 95 9e-20 dbj|GAU46121.1| hypothetical protein TSUD_192820 [Trifolium subt... 90 1e-17 gb|PNY14190.1| pentatricopeptide repeat-containing protein mitoc... 87 7e-17 ref|XP_012573577.1| PREDICTED: pentatricopeptide repeat-containi... 85 4e-16 gb|KRH56887.1| hypothetical protein GLYMA_05G024900 [Glycine max] 82 7e-15 ref|XP_014625174.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-14 ref|XP_020228431.1| pentatricopeptide repeat-containing protein ... 77 3e-13 ref|XP_007155289.1| hypothetical protein PHAVU_003G188300g [Phas... 74 5e-12 ref|XP_014508098.1| pentatricopeptide repeat-containing protein ... 68 3e-10 ref|XP_017412027.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-10 ref|XP_019451534.1| PREDICTED: pentatricopeptide repeat-containi... 62 5e-08 ref|XP_006494986.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 gb|OIW18506.1| hypothetical protein TanjilG_13258 [Lupinus angus... 58 1e-06 ref|XP_008374567.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 dbj|GAY67085.1| hypothetical protein CUMW_253800 [Citrus unshiu] 57 2e-06 >ref|XP_013457923.1| PPR containing plant-like protein [Medicago truncatula] gb|KEH31954.1| PPR containing plant-like protein [Medicago truncatula] Length = 422 Score = 95.1 bits (235), Expect = 9e-20 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = +2 Query: 338 MHGLLSSTWKRCWLQNTSSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGLDDL 514 MH LL+S +KR WLQNTS+HKFQLLS+SL+STLHPIS P LQDLC+IVT T+GGLDDL Sbjct: 1 MHFLLNSAFKRYWLQNTSTHKFQLLSVSLFSTLHPISTPPLLQDLCDIVTSTVGGLDDL 59 >dbj|GAU46121.1| hypothetical protein TSUD_192820 [Trifolium subterraneum] Length = 488 Score = 89.7 bits (221), Expect = 1e-17 Identities = 42/56 (75%), Positives = 48/56 (85%) Frame = +2 Query: 347 LLSSTWKRCWLQNTSSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGLDDL 514 +LSS +KRCW QNTS+ KFQL+S+SLYSTL PIS P LQDLCNIVT T+GGLDDL Sbjct: 1 MLSSAFKRCWPQNTSAIKFQLISVSLYSTLQPISAPPQLQDLCNIVTSTVGGLDDL 56 >gb|PNY14190.1| pentatricopeptide repeat-containing protein mitochondrial-like [Trifolium pratense] Length = 488 Score = 87.4 bits (215), Expect = 7e-17 Identities = 41/56 (73%), Positives = 46/56 (82%) Frame = +2 Query: 347 LLSSTWKRCWLQNTSSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGLDDL 514 +LSS +KRCWLQN+ +HKFQL S SLYSTL IS P LQDLCNIVT T+GGLDDL Sbjct: 1 MLSSAFKRCWLQNSCAHKFQLFSGSLYSTLQSISAPPQLQDLCNIVTSTVGGLDDL 56 >ref|XP_012573577.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial isoform X1 [Cicer arietinum] ref|XP_012573578.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial isoform X2 [Cicer arietinum] Length = 492 Score = 85.1 bits (209), Expect = 4e-16 Identities = 42/59 (71%), Positives = 47/59 (79%) Frame = +2 Query: 338 MHGLLSSTWKRCWLQNTSSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGLDDL 514 MH LL+S KR LQN S+HKFQLLS+S YSTLH IS P LQ+LCNIVT T+GGLDDL Sbjct: 1 MHMLLNSALKRFGLQNKSTHKFQLLSVSFYSTLHSISAPPQLQELCNIVTSTVGGLDDL 59 >gb|KRH56887.1| hypothetical protein GLYMA_05G024900 [Glycine max] Length = 453 Score = 81.6 bits (200), Expect = 7e-15 Identities = 36/59 (61%), Positives = 42/59 (71%) Frame = +2 Query: 338 MHGLLSSTWKRCWLQNTSSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGLDDL 514 MH LL WKR WLQN S+ FQ+ S YSTL P+S HP LQ+LCNIV T+GGLD+L Sbjct: 1 MHALLKPAWKRFWLQNMSTQNFQIFPFSHYSTLQPMSVHPQLQELCNIVMSTVGGLDEL 59 >ref|XP_014625174.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Glycine max] ref|XP_014625175.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Glycine max] ref|XP_014625176.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Glycine max] gb|KRH03514.1| hypothetical protein GLYMA_17G102300 [Glycine max] gb|KRH03515.1| hypothetical protein GLYMA_17G102300 [Glycine max] Length = 490 Score = 81.3 bits (199), Expect = 1e-14 Identities = 35/63 (55%), Positives = 44/63 (69%) Frame = +2 Query: 326 MKFNMHGLLSSTWKRCWLQNTSSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGL 505 M+F MH +L WKR WLQN +H Q+L S YSTL +S HP LQ+LC+IV T+GGL Sbjct: 1 MRFKMHAMLKPAWKRFWLQNMRTHNLQILPFSHYSTLQSMSVHPQLQELCSIVMSTVGGL 60 Query: 506 DDL 514 D+L Sbjct: 61 DEL 63 >ref|XP_020228431.1| pentatricopeptide repeat-containing protein At5g61370, mitochondrial [Cajanus cajan] ref|XP_020228432.1| pentatricopeptide repeat-containing protein At5g61370, mitochondrial [Cajanus cajan] Length = 490 Score = 77.0 bits (188), Expect = 3e-13 Identities = 37/63 (58%), Positives = 42/63 (66%) Frame = +2 Query: 326 MKFNMHGLLSSTWKRCWLQNTSSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGL 505 M+F MH L WK WLQN S+ F LLS S YS L PIS P LQ+LC+IV T+GGL Sbjct: 1 MRFKMHFLFKQAWKCSWLQNMSTQNFLLLSASHYSALPPISVPPRLQELCSIVMSTVGGL 60 Query: 506 DDL 514 DDL Sbjct: 61 DDL 63 >ref|XP_007155289.1| hypothetical protein PHAVU_003G188300g [Phaseolus vulgaris] gb|ESW27283.1| hypothetical protein PHAVU_003G188300g [Phaseolus vulgaris] Length = 494 Score = 73.6 bits (179), Expect = 5e-12 Identities = 33/63 (52%), Positives = 43/63 (68%) Frame = +2 Query: 326 MKFNMHGLLSSTWKRCWLQNTSSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGL 505 M+F MH LL WKR W + S+ Q+++ S YSTL PIS P LQ+LC++V T+GGL Sbjct: 1 MRFMMHVLLKPAWKRSWSKAMSAQNLQIVAFSQYSTLLPISVSPQLQELCSVVVSTVGGL 60 Query: 506 DDL 514 DDL Sbjct: 61 DDL 63 >ref|XP_014508098.1| pentatricopeptide repeat-containing protein At5g61370, mitochondrial [Vigna radiata var. radiata] Length = 496 Score = 68.2 bits (165), Expect = 3e-10 Identities = 31/63 (49%), Positives = 39/63 (61%) Frame = +2 Query: 326 MKFNMHGLLSSTWKRCWLQNTSSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGL 505 M+F H L WKR W + S+ Q+L S YSTL PIS P Q+LC++V T+GGL Sbjct: 1 MRFMTHVLFKPAWKRSWSKAMSTQNLQILLFSQYSTLPPISVSPQFQELCSVVMSTVGGL 60 Query: 506 DDL 514 DDL Sbjct: 61 DDL 63 >ref|XP_017412027.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial [Vigna angularis] ref|XP_017412028.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial [Vigna angularis] gb|KOM33295.1| hypothetical protein LR48_Vigan01g285100 [Vigna angularis] dbj|BAT76562.1| hypothetical protein VIGAN_01458400 [Vigna angularis var. angularis] Length = 496 Score = 68.2 bits (165), Expect = 3e-10 Identities = 30/63 (47%), Positives = 39/63 (61%) Frame = +2 Query: 326 MKFNMHGLLSSTWKRCWLQNTSSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGL 505 M+F H L WKR W + + Q+LS S YSTL P+S P Q+LC++V T+GGL Sbjct: 1 MRFMAHVLFKPAWKRSWSKAMCTQNLQILSFSQYSTLPPVSVSPQFQELCSVVMSTVGGL 60 Query: 506 DDL 514 DDL Sbjct: 61 DDL 63 >ref|XP_019451534.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial [Lupinus angustifolius] Length = 484 Score = 62.0 bits (149), Expect = 5e-08 Identities = 34/63 (53%), Positives = 40/63 (63%) Frame = +2 Query: 326 MKFNMHGLLSSTWKRCWLQNTSSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGL 505 MKFNM L+S WKR WL+ S S YSTL PIS P L++LC+IVT +GGL Sbjct: 1 MKFNM---LNSVWKRSWLKTIR------FSDSFYSTLLPISTTPQLEELCSIVTSNVGGL 51 Query: 506 DDL 514 DDL Sbjct: 52 DDL 54 >ref|XP_006494986.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial [Citrus sinensis] Length = 495 Score = 59.7 bits (143), Expect = 3e-07 Identities = 29/60 (48%), Positives = 37/60 (61%) Frame = +2 Query: 335 NMHGLLSSTWKRCWLQNTSSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGLDDL 514 NMH LL W+ LQ +H F+ L LSLYST+ L++LC +V+ TIGGLDDL Sbjct: 5 NMHVLLKPKWRTLLLQRVDTHNFEHLLLSLYSTVPSNQVSHELKELCKVVSSTIGGLDDL 64 >gb|OIW18506.1| hypothetical protein TanjilG_13258 [Lupinus angustifolius] Length = 480 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/56 (51%), Positives = 36/56 (64%) Frame = +2 Query: 347 LLSSTWKRCWLQNTSSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGLDDL 514 +L+S WKR WL+ S S YSTL PIS P L++LC+IVT +GGLDDL Sbjct: 1 MLNSVWKRSWLKTIR------FSDSFYSTLLPISTTPQLEELCSIVTSNVGGLDDL 50 >ref|XP_008374567.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial [Malus domestica] Length = 501 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/60 (51%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +2 Query: 338 MHGLLSSTWKRCWLQNT-SSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGLDDL 514 M +L S W+R LQN S+ K Q S YST+ P S P LQ+LC IV+ IGGLDDL Sbjct: 1 MRSVLLSKWQRFLLQNAVSTQKSQFFSCFYYSTMLPASSPPELQELCTIVSSAIGGLDDL 60 >dbj|GAY67085.1| hypothetical protein CUMW_253800 [Citrus unshiu] Length = 493 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/59 (47%), Positives = 36/59 (61%) Frame = +2 Query: 338 MHGLLSSTWKRCWLQNTSSHKFQLLSLSLYSTLHPISPHPHLQDLCNIVTGTIGGLDDL 514 MH LL W+ LQ +H F+ L LSLYST+ L++LC +V+ TIGGLDDL Sbjct: 6 MHVLLKPKWRSLLLQRVDTHNFEHLLLSLYSTVPSNQVSHELKELCKVVSSTIGGLDDL 64