BLASTX nr result
ID: Angelica27_contig00041523
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00041523 (310 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017257542.1 PREDICTED: defensin-like protein [Daucus carota s... 91 3e-21 KJB11911.1 hypothetical protein B456_002G029500 [Gossypium raimo... 53 5e-07 KOM30514.1 hypothetical protein LR48_Vigan01g006800 [Vigna angul... 51 2e-06 XP_013461626.1 Defensin [Medicago truncatula] KEH35661.1 Defensi... 51 2e-06 XP_006384382.1 hypothetical protein POPTR_0004s14520g [Populus t... 51 3e-06 XP_016902617.1 PREDICTED: defensin-like protein 1 [Cucumis melo] 51 3e-06 XP_016733843.1 PREDICTED: defensin D2-like [Gossypium hirsutum] 50 6e-06 XP_012453279.1 PREDICTED: defensin D2-like [Gossypium raimondii] 50 6e-06 XP_016724263.1 PREDICTED: defensin D2-like [Gossypium hirsutum] ... 50 6e-06 KJB11913.1 hypothetical protein B456_002G029700 [Gossypium raimo... 50 6e-06 XP_004509604.1 PREDICTED: defensin-like protein 1 [Cicer arietinum] 50 6e-06 EEF49129.1 8.4 kDa sulfur-rich protein precursor, putative [Rici... 50 7e-06 >XP_017257542.1 PREDICTED: defensin-like protein [Daucus carota subsp. sativus] KZM92724.1 hypothetical protein DCAR_019911 [Daucus carota subsp. sativus] Length = 129 Score = 90.5 bits (223), Expect = 3e-21 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +1 Query: 1 VRSAYFIGFCLIDHYCEMVCKIEGFPGGQCLGLVPHCICLGTC 129 VRSAYF+ CLIDH+CEMVCK+EGFP G+CLGLVPHCICLGTC Sbjct: 33 VRSAYFVSLCLIDHHCEMVCKVEGFPTGKCLGLVPHCICLGTC 75 >KJB11911.1 hypothetical protein B456_002G029500 [Gossypium raimondii] Length = 78 Score = 52.8 bits (125), Expect = 5e-07 Identities = 21/42 (50%), Positives = 26/42 (61%) Frame = +1 Query: 4 RSAYFIGFCLIDHYCEMVCKIEGFPGGQCLGLVPHCICLGTC 129 RS F G CL D+ C++VCK EGFP G C G + C+C C Sbjct: 37 RSNAFKGLCLRDNNCDIVCKTEGFPNGGCKGFIRKCVCTKPC 78 >KOM30514.1 hypothetical protein LR48_Vigan01g006800 [Vigna angularis] BAT73192.1 hypothetical protein VIGAN_01065700 [Vigna angularis var. angularis] Length = 76 Score = 51.2 bits (121), Expect = 2e-06 Identities = 20/41 (48%), Positives = 25/41 (60%) Frame = +1 Query: 7 SAYFIGFCLIDHYCEMVCKIEGFPGGQCLGLVPHCICLGTC 129 S F G C+I +C C EGF GG+C G +PHC C+ TC Sbjct: 35 SMTFKGICIISKHCAKACLNEGFNGGKCKGFLPHCDCVYTC 75 >XP_013461626.1 Defensin [Medicago truncatula] KEH35661.1 Defensin [Medicago truncatula] Length = 73 Score = 50.8 bits (120), Expect = 2e-06 Identities = 20/42 (47%), Positives = 23/42 (54%) Frame = +1 Query: 4 RSAYFIGFCLIDHYCEMVCKIEGFPGGQCLGLVPHCICLGTC 129 +S F G C+ DH C VC +EGFPGG C G C C C Sbjct: 32 KSHRFKGMCMSDHNCASVCHVEGFPGGNCRGFRRRCFCKKRC 73 >XP_006384382.1 hypothetical protein POPTR_0004s14520g [Populus trichocarpa] ERP62179.1 hypothetical protein POPTR_0004s14520g [Populus trichocarpa] Length = 74 Score = 50.8 bits (120), Expect = 3e-06 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = +1 Query: 4 RSAYFIGFCLIDHYCEMVCKIEGFPGGQCLGLVPHCICLGTC 129 +S ++ G CL H C MVCK EGF GG+C G + C C C Sbjct: 33 QSHHYKGPCLRGHNCAMVCKTEGFAGGECKGFISRCFCAKLC 74 >XP_016902617.1 PREDICTED: defensin-like protein 1 [Cucumis melo] Length = 79 Score = 50.8 bits (120), Expect = 3e-06 Identities = 19/42 (45%), Positives = 26/42 (61%) Frame = +1 Query: 4 RSAYFIGFCLIDHYCEMVCKIEGFPGGQCLGLVPHCICLGTC 129 +S +F G C+ DH C +VC+ EGF GG+C+G C C C Sbjct: 38 QSHHFHGTCIRDHNCALVCRTEGFSGGECVGFRRRCFCTHRC 79 >XP_016733843.1 PREDICTED: defensin D2-like [Gossypium hirsutum] Length = 78 Score = 50.1 bits (118), Expect = 6e-06 Identities = 19/38 (50%), Positives = 23/38 (60%) Frame = +1 Query: 16 FIGFCLIDHYCEMVCKIEGFPGGQCLGLVPHCICLGTC 129 F G CL D C++VCK EGFP G C G + C+C C Sbjct: 41 FKGLCLRDDNCDIVCKTEGFPNGDCKGFLRKCVCTKPC 78 >XP_012453279.1 PREDICTED: defensin D2-like [Gossypium raimondii] Length = 78 Score = 50.1 bits (118), Expect = 6e-06 Identities = 19/38 (50%), Positives = 23/38 (60%) Frame = +1 Query: 16 FIGFCLIDHYCEMVCKIEGFPGGQCLGLVPHCICLGTC 129 F G CL D C++VCK EGFP G C G + C+C C Sbjct: 41 FKGLCLRDDNCDIVCKTEGFPNGDCKGFLRKCVCTKPC 78 >XP_016724263.1 PREDICTED: defensin D2-like [Gossypium hirsutum] KJB11914.1 hypothetical protein B456_002G029700 [Gossypium raimondii] Length = 78 Score = 50.1 bits (118), Expect = 6e-06 Identities = 19/38 (50%), Positives = 23/38 (60%) Frame = +1 Query: 16 FIGFCLIDHYCEMVCKIEGFPGGQCLGLVPHCICLGTC 129 F G CL D C++VCK EGFP G C G + C+C C Sbjct: 41 FKGLCLRDDNCDIVCKTEGFPNGDCKGFLRKCVCTKPC 78 >KJB11913.1 hypothetical protein B456_002G029700 [Gossypium raimondii] Length = 78 Score = 50.1 bits (118), Expect = 6e-06 Identities = 19/38 (50%), Positives = 23/38 (60%) Frame = +1 Query: 16 FIGFCLIDHYCEMVCKIEGFPGGQCLGLVPHCICLGTC 129 F G CL D C++VCK EGFP G C G + C+C C Sbjct: 41 FKGLCLRDDNCDIVCKTEGFPNGDCKGFLRKCVCTKPC 78 >XP_004509604.1 PREDICTED: defensin-like protein 1 [Cicer arietinum] Length = 78 Score = 50.1 bits (118), Expect = 6e-06 Identities = 22/42 (52%), Positives = 26/42 (61%) Frame = +1 Query: 4 RSAYFIGFCLIDHYCEMVCKIEGFPGGQCLGLVPHCICLGTC 129 +S F G C+IDH C +VC+ EGF GGQC GL C C C Sbjct: 37 QSNTFKGPCVIDHSCAIVCQTEGFTGGQCEGLRRICFCTKPC 78 >EEF49129.1 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis] Length = 74 Score = 49.7 bits (117), Expect = 7e-06 Identities = 21/42 (50%), Positives = 25/42 (59%) Frame = +1 Query: 4 RSAYFIGFCLIDHYCEMVCKIEGFPGGQCLGLVPHCICLGTC 129 +S YF G CL DH C MVC+ E F GG+C G+ C C C Sbjct: 33 QSHYFKGPCLRDHNCAMVCRNEAFSGGRCKGVRRRCFCTKLC 74