BLASTX nr result
ID: Angelica27_contig00041279
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00041279 (233 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017243866.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 84 1e-18 XP_009763488.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 65 2e-11 ABF06704.1 Joka20, partial [Nicotiana plumbaginifolia] 65 3e-11 XP_016453427.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 65 3e-11 XP_009773575.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 65 3e-11 XP_009606487.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 65 4e-11 XP_019253732.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 65 4e-11 XP_017255063.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 65 4e-11 CAA44226.1 ribosomal protein L12-1a [Nicotiana tabacum] 65 5e-11 XP_016452515.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 64 5e-11 XP_009804033.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 64 5e-11 XP_016561564.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 64 1e-10 XP_006338570.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 64 1e-10 XP_015067014.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 63 2e-10 XP_006338571.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 63 2e-10 XP_012840675.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 62 3e-10 KZV32944.1 hypothetical protein F511_01455 [Dorcoceras hygrometr... 62 5e-10 XP_015066505.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 62 5e-10 XP_010316288.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 62 5e-10 XP_012849599.1 PREDICTED: 50S ribosomal protein L12, chloroplast... 62 7e-10 >XP_017243866.1 PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Daucus carota subsp. sativus] KZM97585.1 hypothetical protein DCAR_015053 [Daucus carota subsp. sativus] Length = 185 Score = 84.3 bits (207), Expect = 1e-18 Identities = 52/82 (63%), Positives = 55/82 (67%), Gaps = 7/82 (8%) Frame = +3 Query: 9 MASSTLSTLLVPLQRXXXXXXXXXXXXX-------LIPFPKHLRNSATFLRPISAVEAPE 167 MASST STLLVPLQR LI PKH RN FLRP+SAVEAPE Sbjct: 1 MASSTPSTLLVPLQRSSSYSHPVNSSISYPTHPNSLISSPKHQRN---FLRPVSAVEAPE 57 Query: 168 KVVELGDKISDLTLSDAQKLVE 233 KVVELGDKISDLTLSDAQKL++ Sbjct: 58 KVVELGDKISDLTLSDAQKLID 79 >XP_009763488.1 PREDICTED: 50S ribosomal protein L12, chloroplastic-like, partial [Nicotiana sylvestris] Length = 165 Score = 65.1 bits (157), Expect = 2e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK ATFLRP++AVEAPEKVV+LGD+IS+LTL+DAQKLVE Sbjct: 22 PKLQNRRATFLRPLAAVEAPEKVVQLGDEISNLTLADAQKLVE 64 >ABF06704.1 Joka20, partial [Nicotiana plumbaginifolia] Length = 161 Score = 64.7 bits (156), Expect = 3e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK ATFLRP++AVEAPEKVV+LGD+IS+LTL+DAQKLVE Sbjct: 39 PKLHHRRATFLRPLAAVEAPEKVVQLGDEISNLTLADAQKLVE 81 >XP_016453427.1 PREDICTED: 50S ribosomal protein L12, chloroplastic [Nicotiana tabacum] P36688.1 RecName: Full=50S ribosomal protein L12, chloroplastic; AltName: Full=CL12; Flags: Precursor AAB21989.1 ribosomal protein L12 (chloroplast) [Nicotiana sylvestris] Length = 186 Score = 65.1 bits (157), Expect = 3e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK ATFLRP++AVEAPEKVV+LGD+IS+LTL+DAQKLVE Sbjct: 39 PKLQNRRATFLRPLAAVEAPEKVVQLGDEISNLTLADAQKLVE 81 >XP_009773575.1 PREDICTED: 50S ribosomal protein L12, chloroplastic [Nicotiana sylvestris] Length = 186 Score = 65.1 bits (157), Expect = 3e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK ATFLRP++AVEAPEKVV+LGD+IS+LTL+DAQKLVE Sbjct: 39 PKLQNRRATFLRPLAAVEAPEKVVQLGDEISNLTLADAQKLVE 81 >XP_009606487.1 PREDICTED: 50S ribosomal protein L12, chloroplastic [Nicotiana tomentosiformis] XP_016442894.1 PREDICTED: 50S ribosomal protein L12, chloroplastic [Nicotiana tabacum] P24929.1 RecName: Full=50S ribosomal protein L12, chloroplastic; AltName: Full=CL12; Flags: Precursor CAA44214.1 ribosomal protein L12-1 [Nicotiana tabacum] Length = 186 Score = 64.7 bits (156), Expect = 4e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK ATFLRP++AVEAPEKVV+LGD+IS+LTL+DAQKLVE Sbjct: 39 PKLHHRRATFLRPLAAVEAPEKVVQLGDEISNLTLADAQKLVE 81 >XP_019253732.1 PREDICTED: 50S ribosomal protein L12, chloroplastic [Nicotiana attenuata] OIS98962.1 50s ribosomal protein l12, chloroplastic [Nicotiana attenuata] Length = 188 Score = 64.7 bits (156), Expect = 4e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK ATFLRP++AVEAPEKVV+LGD+IS+LTL+DAQKLVE Sbjct: 41 PKLHHRRATFLRPLAAVEAPEKVVQLGDEISNLTLADAQKLVE 83 >XP_017255063.1 PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Daucus carota subsp. sativus] KZM90941.1 hypothetical protein DCAR_021694 [Daucus carota subsp. sativus] Length = 188 Score = 64.7 bits (156), Expect = 4e-11 Identities = 42/83 (50%), Positives = 52/83 (62%), Gaps = 8/83 (9%) Frame = +3 Query: 9 MASSTLSTLLVPLQRXXXXXXXXXXXXX---LIPFPKHLRNS-----ATFLRPISAVEAP 164 MASS LST++V L+ + FPK S AT LRP++AV+AP Sbjct: 1 MASSVLSTVVVSLRSTTSYPTPSSYPSPNPLTLSFPKQTPFSLRTHRATHLRPLAAVDAP 60 Query: 165 EKVVELGDKISDLTLSDAQKLVE 233 EKVV+LGD+IS+LTLSDAQKLVE Sbjct: 61 EKVVDLGDQISNLTLSDAQKLVE 83 >CAA44226.1 ribosomal protein L12-1a [Nicotiana tabacum] Length = 191 Score = 64.7 bits (156), Expect = 5e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK ATFLRP++AVEAPEKVV+LGD+IS+LTL+DAQKLVE Sbjct: 39 PKLHHRRATFLRPLAAVEAPEKVVQLGDEISNLTLADAQKLVE 81 >XP_016452515.1 PREDICTED: 50S ribosomal protein L12, chloroplastic-like, partial [Nicotiana tabacum] Length = 174 Score = 64.3 bits (155), Expect = 5e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK ATFLRP++AVEAPEKVV+LGD+IS+LTL+DAQKLVE Sbjct: 27 PKLENPGATFLRPLAAVEAPEKVVQLGDEISNLTLADAQKLVE 69 >XP_009804033.1 PREDICTED: 50S ribosomal protein L12, chloroplastic-like, partial [Nicotiana sylvestris] Length = 174 Score = 64.3 bits (155), Expect = 5e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK ATFLRP++AVEAPEKVV+LGD+IS+LTL+DAQKLVE Sbjct: 27 PKLENPGATFLRPLAAVEAPEKVVQLGDEISNLTLADAQKLVE 69 >XP_016561564.1 PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Capsicum annuum] Length = 188 Score = 63.5 bits (153), Expect = 1e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK R ATF+RP++AV+APEKVV+LGD+IS LTL+DAQKLVE Sbjct: 39 PKLHRRRATFVRPLAAVDAPEKVVQLGDEISTLTLADAQKLVE 81 >XP_006338570.1 PREDICTED: 50S ribosomal protein L12, chloroplastic [Solanum tuberosum] Length = 190 Score = 63.5 bits (153), Expect = 1e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK ATF+RP++AVEAPEKVV+LGD+IS+LTL+DAQKLVE Sbjct: 42 PKLHHRRATFVRPLAAVEAPEKVVQLGDEISNLTLADAQKLVE 84 >XP_015067014.1 PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Solanum pennellii] Length = 186 Score = 62.8 bits (151), Expect = 2e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK ATF+RP++AVEAPEKVV+LGD+IS LTL+DAQKLVE Sbjct: 38 PKLHHRRATFVRPLAAVEAPEKVVQLGDEISTLTLADAQKLVE 80 >XP_006338571.1 PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Solanum tuberosum] Length = 190 Score = 62.8 bits (151), Expect = 2e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK ATF+RP++AVEAPEKVV+LGD+IS LTL+DAQKLVE Sbjct: 42 PKLHHRRATFVRPLAAVEAPEKVVQLGDEISTLTLADAQKLVE 84 >XP_012840675.1 PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Erythranthe guttata] EYU34722.1 hypothetical protein MIMGU_mgv1a014613mg [Erythranthe guttata] Length = 184 Score = 62.4 bits (150), Expect = 3e-10 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK +R AT +RP++AV+APEKVV+LGD+IS LTL+DAQKLVE Sbjct: 39 PKLIRRRATAVRPLAAVDAPEKVVQLGDEISTLTLADAQKLVE 81 >KZV32944.1 hypothetical protein F511_01455 [Dorcoceras hygrometricum] Length = 189 Score = 62.0 bits (149), Expect = 5e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +3 Query: 126 ATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 AT LRPISAV+APEKVVELGD+IS+LTL+DAQKLVE Sbjct: 50 ATVLRPISAVDAPEKVVELGDQISNLTLADAQKLVE 85 >XP_015066505.1 PREDICTED: 50S ribosomal protein L12, chloroplastic [Solanum pennellii] Length = 190 Score = 62.0 bits (149), Expect = 5e-10 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK AT +RP++AVEAPEKVV+LGD+IS+LTL+DAQKLVE Sbjct: 42 PKLYHRRATLVRPLAAVEAPEKVVQLGDEISNLTLADAQKLVE 84 >XP_010316288.1 PREDICTED: 50S ribosomal protein L12, chloroplastic [Solanum lycopersicum] Length = 190 Score = 62.0 bits (149), Expect = 5e-10 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 PK AT +RP++AVEAPEKVV+LGD+IS+LTL+DAQKLVE Sbjct: 42 PKLYHRRATLVRPLAAVEAPEKVVQLGDEISNLTLADAQKLVE 84 >XP_012849599.1 PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Erythranthe guttata] EYU44759.1 hypothetical protein MIMGU_mgv1a014490mg [Erythranthe guttata] Length = 188 Score = 61.6 bits (148), Expect = 7e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 105 PKHLRNSATFLRPISAVEAPEKVVELGDKISDLTLSDAQKLVE 233 P LR + +RPISAV+APEKVVELGD+IS+LTL+DAQKLVE Sbjct: 43 PALLRRRTSAVRPISAVDAPEKVVELGDQISNLTLADAQKLVE 85