BLASTX nr result
ID: Angelica27_contig00040950
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00040950 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFG63006.1 hypothetical protein 0_2690_02, partial [Pinus taeda]... 50 2e-06 >AFG63006.1 hypothetical protein 0_2690_02, partial [Pinus taeda] AFG63007.1 hypothetical protein 0_2690_02, partial [Pinus taeda] AFG63008.1 hypothetical protein 0_2690_02, partial [Pinus taeda] AFG63009.1 hypothetical protein 0_2690_02, partial [Pinus taeda] AFG63010.1 hypothetical protein 0_2690_02, partial [Pinus taeda] AFG63011.1 hypothetical protein 0_2690_02, partial [Pinus taeda] Length = 60 Score = 50.4 bits (119), Expect = 2e-06 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = -3 Query: 107 FQLDEAQVERMRQQEALHLNIEKHLKKINKPPVKT 3 F L EA+V R+RQQE LHL+IE HLK++NKP V++ Sbjct: 8 FTLGEAEVNRLRQQEQLHLDIENHLKRLNKPAVQS 42