BLASTX nr result
ID: Angelica27_contig00040874
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00040874 (249 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM81398.1 hypothetical protein DCAR_029011 [Daucus carota subsp... 80 3e-16 XP_017224194.1 PREDICTED: cell division cycle-associated 7-like ... 80 4e-16 >KZM81398.1 hypothetical protein DCAR_029011 [Daucus carota subsp. sativus] Length = 305 Score = 80.5 bits (197), Expect = 3e-16 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 1 PTKENPHPQNGSLPTASGESEPTDGSLQSDDTGSEEIEEDSDLGSINGGTYNQ 159 PTKE+P QNG LPT +GESEPT G S G+EEIEEDSDLGS+NGGTYNQ Sbjct: 237 PTKEDPDSQNGLLPTTNGESEPTYGISNSQSDGNEEIEEDSDLGSMNGGTYNQ 289 >XP_017224194.1 PREDICTED: cell division cycle-associated 7-like protein [Daucus carota subsp. sativus] Length = 335 Score = 80.5 bits (197), Expect = 4e-16 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = +1 Query: 1 PTKENPHPQNGSLPTASGESEPTDGSLQSDDTGSEEIEEDSDLGSINGGTYNQ 159 PTKE+P QNG LPT +GESEPT G S G+EEIEEDSDLGS+NGGTYNQ Sbjct: 267 PTKEDPDSQNGLLPTTNGESEPTYGISNSQSDGNEEIEEDSDLGSMNGGTYNQ 319