BLASTX nr result
ID: Angelica27_contig00040866
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00040866 (340 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017241857.1 PREDICTED: histone acetyltransferase HAC1-like [D... 54 7e-06 >XP_017241857.1 PREDICTED: histone acetyltransferase HAC1-like [Daucus carota subsp. sativus] KZN02950.1 hypothetical protein DCAR_011706 [Daucus carota subsp. sativus] Length = 1502 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/44 (63%), Positives = 32/44 (72%), Gaps = 4/44 (9%) Frame = +1 Query: 25 VLCRKM*NLL*LHARSCKVSVCHVPHHID----SRRNQQQADCR 144 +LCR+M NLL LHARSCK+S CHVP D RR+QQQAD R Sbjct: 1438 LLCRRMWNLLQLHARSCKISECHVPRCRDLREHFRRHQQQADSR 1481