BLASTX nr result
ID: Angelica27_contig00040841
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00040841 (263 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017258073.1 PREDICTED: L10-interacting MYB domain-containing ... 130 6e-34 KZM92404.1 hypothetical protein DCAR_020231 [Daucus carota subsp... 81 2e-16 XP_016462634.1 PREDICTED: L10-interacting MYB domain-containing ... 60 2e-09 JAT52365.1 DNA repair protein XRCC4 [Anthurium amnicola] 61 5e-09 XP_019239273.1 PREDICTED: uncharacterized protein At2g29880-like... 60 5e-09 XP_016511023.1 PREDICTED: L10-interacting MYB domain-containing ... 60 1e-08 XP_018630676.1 PREDICTED: L10-interacting MYB domain-containing ... 60 1e-08 XP_016441046.1 PREDICTED: L10-interacting MYB domain-containing ... 56 7e-08 XP_004499412.1 PREDICTED: uncharacterized protein LOC101514034 [... 56 8e-08 JAT60260.1 DNA repair protein XRCC4, partial [Anthurium amnicola] 57 1e-07 XP_018626213.1 PREDICTED: uncharacterized protein LOC108942806 [... 56 1e-07 XP_018722940.1 PREDICTED: uncharacterized protein LOC108957121 [... 57 2e-07 XP_008244457.1 PREDICTED: L10-interacting MYB domain-containing ... 54 2e-07 KNA13501.1 hypothetical protein SOVF_116390 [Spinacia oleracea] 56 3e-07 XP_019066896.1 PREDICTED: L10-interacting MYB domain-containing ... 56 3e-07 XP_015073206.1 PREDICTED: L10-interacting MYB domain-containing ... 56 3e-07 XP_004248774.2 PREDICTED: L10-interacting MYB domain-containing ... 56 3e-07 JAT42275.1 UvrABC system protein C, partial [Anthurium amnicola] 55 7e-07 JAU74022.1 hypothetical protein LE_TR11009_c0_g1_i1_g.36456, par... 55 7e-07 XP_015960000.1 PREDICTED: L10-interacting MYB domain-containing ... 55 9e-07 >XP_017258073.1 PREDICTED: L10-interacting MYB domain-containing protein-like [Daucus carota subsp. sativus] Length = 470 Score = 130 bits (326), Expect = 6e-34 Identities = 65/88 (73%), Positives = 73/88 (82%), Gaps = 2/88 (2%) Frame = +1 Query: 1 LEVRQKELDDGFRELESKKMEIANKIAGIKCSYAGAVTVKQE--RLSARWDDSSHRVFIK 174 LEVRQKELDDGFRELE +K E ANKI+GIK S AG V VKQE SA+WDD +HR+F + Sbjct: 129 LEVRQKELDDGFRELELRKREFANKISGIKRSNAGVVKVKQEPSSASAKWDDDTHRIFTE 188 Query: 175 LCVDEVRKGNRPCTTLSKTGWANVHKEF 258 LCV+EVRKGN+P TTLSKTGWANV KEF Sbjct: 189 LCVNEVRKGNKPRTTLSKTGWANVRKEF 216 >KZM92404.1 hypothetical protein DCAR_020231 [Daucus carota subsp. sativus] Length = 312 Score = 81.3 bits (199), Expect = 2e-16 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 2/54 (3%) Frame = +1 Query: 103 GAVTVKQE--RLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 G V VKQE SA+WDD +HR+F +LCV+EVRKGN+P TTLSKTGWANV KEF Sbjct: 5 GVVKVKQEPSSASAKWDDDTHRIFTELCVNEVRKGNKPRTTLSKTGWANVRKEF 58 >XP_016462634.1 PREDICTED: L10-interacting MYB domain-containing protein-like [Nicotiana tabacum] Length = 145 Score = 59.7 bits (143), Expect = 2e-09 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +1 Query: 124 ERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 ER +A+WD+ +H FI+LC EVRKGNRP T LSK GW N+ EF Sbjct: 3 ERHNAKWDEYAHIKFIELCEQEVRKGNRPNTYLSKDGWKNMVNEF 47 >JAT52365.1 DNA repair protein XRCC4 [Anthurium amnicola] Length = 473 Score = 61.2 bits (147), Expect = 5e-09 Identities = 25/52 (48%), Positives = 37/52 (71%) Frame = +1 Query: 103 GAVTVKQERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 G +K +R+ A WDD H VFIK+C+D++R GN+P TL+K G+ N+ +EF Sbjct: 162 GKQKLKGDRVKAVWDDKKHAVFIKICLDQMRAGNKPHKTLNKLGYMNLEREF 213 >XP_019239273.1 PREDICTED: uncharacterized protein At2g29880-like [Nicotiana attenuata] Length = 245 Score = 60.5 bits (145), Expect = 5e-09 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = +1 Query: 121 QERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 +ER +A+WD+ +H FI+LC EVRKGNRP T LSK GW N+ EF Sbjct: 2 EERHNAKWDEYAHIKFIELCEQEVRKGNRPNTYLSKDGWKNMVNEF 47 >XP_016511023.1 PREDICTED: L10-interacting MYB domain-containing protein-like [Nicotiana tabacum] Length = 293 Score = 59.7 bits (143), Expect = 1e-08 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +1 Query: 124 ERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 ER +A+WD+ +H FI+LC EVRKGNRP T LSK GW N+ EF Sbjct: 3 ERHNAKWDEYAHIKFIELCEQEVRKGNRPNTYLSKDGWKNMVNEF 47 >XP_018630676.1 PREDICTED: L10-interacting MYB domain-containing protein-like [Nicotiana tomentosiformis] Length = 305 Score = 59.7 bits (143), Expect = 1e-08 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +1 Query: 124 ERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 ER +A+WD+ +H FI+LC EVRKGNRP T LSK GW N+ EF Sbjct: 3 ERHNAKWDEYAHIKFIELCEQEVRKGNRPNTYLSKDGWKNMVNEF 47 >XP_016441046.1 PREDICTED: L10-interacting MYB domain-containing protein-like [Nicotiana tabacum] Length = 162 Score = 56.2 bits (134), Expect = 7e-08 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = +1 Query: 124 ERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 ER +A+WD+ +H FI+LC EVRKG RP T LSK GW N+ EF Sbjct: 3 ERHNAKWDEYAHIKFIELCEQEVRKGIRPNTYLSKDGWKNMVNEF 47 >XP_004499412.1 PREDICTED: uncharacterized protein LOC101514034 [Cicer arietinum] Length = 148 Score = 55.8 bits (133), Expect = 8e-08 Identities = 21/44 (47%), Positives = 31/44 (70%) Frame = +1 Query: 127 RLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 R+ ARWDD+ F+K+C++E+ GNRP T SK GW N+ ++F Sbjct: 18 RIVARWDDTKTEPFLKICIEEIEAGNRPDTHFSKEGWKNITEKF 61 >JAT60260.1 DNA repair protein XRCC4, partial [Anthurium amnicola] Length = 499 Score = 57.4 bits (137), Expect = 1e-07 Identities = 22/48 (45%), Positives = 35/48 (72%) Frame = +1 Query: 115 VKQERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 +K +R+ A WDD H VFIK+C++++R GN+P L+K G+ N+ +EF Sbjct: 195 LKGDRIKAAWDDKRHAVFIKICLNQMRAGNKPHRNLNKLGYLNLEREF 242 >XP_018626213.1 PREDICTED: uncharacterized protein LOC108942806 [Nicotiana tomentosiformis] Length = 208 Score = 56.2 bits (134), Expect = 1e-07 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = +1 Query: 133 SARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 +A+WDD H FI+LC E+RK NRP T LSK GW N+ EF Sbjct: 5 NAKWDDEVHITFIELCEQEIRKKNRPNTYLSKDGWKNIINEF 46 >XP_018722940.1 PREDICTED: uncharacterized protein LOC108957121 [Eucalyptus grandis] Length = 665 Score = 56.6 bits (135), Expect = 2e-07 Identities = 22/48 (45%), Positives = 34/48 (70%) Frame = +1 Query: 118 KQERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEFI 261 +++ +A+W +S +FI L VDEV+KGNR +T +K GW N+H EF+ Sbjct: 4 ERQTCNAKWTESVTNIFIGLLVDEVKKGNRTTSTFNKAGWRNIHSEFV 51 >XP_008244457.1 PREDICTED: L10-interacting MYB domain-containing protein-like [Prunus mume] XP_008245570.1 PREDICTED: L10-interacting MYB domain-containing protein-like [Prunus mume] Length = 131 Score = 54.3 bits (129), Expect = 2e-07 Identities = 23/47 (48%), Positives = 31/47 (65%) Frame = +1 Query: 118 KQERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 K+++ A+WDD VFIK+CV E GNRP + +K GW NV K+F Sbjct: 17 KEKQEKAKWDDKGTEVFIKICVAETLGGNRPSSHFNKVGWKNVIKKF 63 >KNA13501.1 hypothetical protein SOVF_116390 [Spinacia oleracea] Length = 321 Score = 56.2 bits (134), Expect = 3e-07 Identities = 24/47 (51%), Positives = 31/47 (65%) Frame = +1 Query: 118 KQERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 K +R A WDD S R+F ++C DEV GNRP T ++ GW NV K+F Sbjct: 5 KVKRSKATWDDESTRIFCEVCADEVHAGNRPNTHFNRVGWDNVVKKF 51 >XP_019066896.1 PREDICTED: L10-interacting MYB domain-containing protein-like [Solanum lycopersicum] Length = 266 Score = 55.8 bits (133), Expect = 3e-07 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = +1 Query: 115 VKQERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 + + + +A+WD+ +H FI+LC E+RKGNRP T LSK GW N K F Sbjct: 1 MSETQTNAKWDNDAHLKFIELCELEIRKGNRPNTHLSKDGWKNTIKAF 48 >XP_015073206.1 PREDICTED: L10-interacting MYB domain-containing protein-like [Solanum pennellii] Length = 312 Score = 55.8 bits (133), Expect = 3e-07 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = +1 Query: 115 VKQERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 + + + +A+WD+ +H FI+LC E+RKGNRP T LSK GW N K F Sbjct: 1 MSETQTNAKWDNDAHLKFIELCELEIRKGNRPNTHLSKDGWKNTIKAF 48 >XP_004248774.2 PREDICTED: L10-interacting MYB domain-containing protein-like [Solanum lycopersicum] Length = 312 Score = 55.8 bits (133), Expect = 3e-07 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = +1 Query: 115 VKQERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 + + + +A+WD+ +H FI+LC E+RKGNRP T LSK GW N K F Sbjct: 1 MSETQTNAKWDNDAHLKFIELCELEIRKGNRPNTHLSKDGWKNTIKAF 48 >JAT42275.1 UvrABC system protein C, partial [Anthurium amnicola] Length = 400 Score = 55.1 bits (131), Expect = 7e-07 Identities = 22/57 (38%), Positives = 33/57 (57%) Frame = +1 Query: 88 KCSYAGAVTVKQERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 +C G + A W D + FI +C+DEVRKGNRP T+ +++GW N+ + F Sbjct: 86 QCYKMGLKGKLSSQCKANWTDEYKKAFIDICLDEVRKGNRPTTSFNRSGWVNITERF 142 >JAU74022.1 hypothetical protein LE_TR11009_c0_g1_i1_g.36456, partial [Noccaea caerulescens] Length = 461 Score = 55.1 bits (131), Expect = 7e-07 Identities = 28/83 (33%), Positives = 43/83 (51%) Frame = +1 Query: 10 RQKELDDGFRELESKKMEIANKIAGIKCSYAGAVTVKQERLSARWDDSSHRVFIKLCVDE 189 R+K + R L+ + + I + Y V ++ R A W+ HRVF+ LCV++ Sbjct: 4 REKARKNRDRLLQPHPSQCRHSIQSLSRFYRIPVRERKMRPKAVWEPDYHRVFLDLCVEQ 63 Query: 190 VRKGNRPCTTLSKTGWANVHKEF 258 +GN+P T SK GW N+ K F Sbjct: 64 TLQGNKPRTHFSKQGWRNILKSF 86 >XP_015960000.1 PREDICTED: L10-interacting MYB domain-containing protein-like [Arachis duranensis] Length = 303 Score = 54.7 bits (130), Expect = 9e-07 Identities = 21/45 (46%), Positives = 31/45 (68%) Frame = +1 Query: 124 ERLSARWDDSSHRVFIKLCVDEVRKGNRPCTTLSKTGWANVHKEF 258 E + A+WDD + +F+ +CV+E+R GNRP SK GW N+ K+F Sbjct: 28 ETVKAKWDDWNTEIFLTICVEEIRDGNRPNKHFSKIGWKNLQKKF 72