BLASTX nr result
ID: Angelica27_contig00040830
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00040830 (310 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN00836.1 hypothetical protein DCAR_009590 [Daucus carota subsp... 59 3e-08 KZN04269.1 hypothetical protein DCAR_005089 [Daucus carota subsp... 53 6e-06 XP_017232955.1 PREDICTED: ankyrin-3-like [Daucus carota subsp. s... 53 6e-06 >KZN00836.1 hypothetical protein DCAR_009590 [Daucus carota subsp. sativus] Length = 212 Score = 58.5 bits (140), Expect = 3e-08 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 3 YVVLSHSPVLTITIYISGCFFFPLVIVLLIEMIYDHKLEK 122 YVVLSHS L IT+ + GCFFF LVI+L I+MI+DHK+EK Sbjct: 165 YVVLSHSLALAITVCMIGCFFFLLVIILTIKMIFDHKVEK 204 >KZN04269.1 hypothetical protein DCAR_005089 [Daucus carota subsp. sativus] Length = 837 Score = 53.1 bits (126), Expect = 6e-06 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = +3 Query: 3 YVVLSHSPVLTITIYISGCFFFPLVIVLLIEMIYDHKLEK 122 YVVLSHSP + IT+ + G FFF VIVLLI+MIYD ++++ Sbjct: 795 YVVLSHSPAIAITVCLIGSFFFLFVIVLLIKMIYDRQVKR 834 >XP_017232955.1 PREDICTED: ankyrin-3-like [Daucus carota subsp. sativus] Length = 1287 Score = 53.1 bits (126), Expect = 6e-06 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = +3 Query: 3 YVVLSHSPVLTITIYISGCFFFPLVIVLLIEMIYDHKLEK 122 YVVLSHSP + IT+ + G FFF VIVLLI+MIYD ++++ Sbjct: 1245 YVVLSHSPAIAITVCLIGSFFFLFVIVLLIKMIYDRQVKR 1284