BLASTX nr result
ID: Angelica27_contig00040827
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00040827 (293 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017240779.1 PREDICTED: LOB domain-containing protein 36-like ... 80 1e-15 >XP_017240779.1 PREDICTED: LOB domain-containing protein 36-like [Daucus carota subsp. sativus] Length = 332 Score = 79.7 bits (195), Expect = 1e-15 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 293 MSVSAGMAPALVLGSFEGPYQTQEHKQNDQPHHQLQATQAFLEE 162 M VSAGMAPAL LGSFEG YQTQ+H QNDQPHH+LQATQ FLEE Sbjct: 233 MGVSAGMAPALGLGSFEGSYQTQQHTQNDQPHHELQATQTFLEE 276