BLASTX nr result
ID: Angelica27_contig00040151
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00040151 (416 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017228624.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 7e-24 >XP_017228624.1 PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Daucus carota subsp. sativus] XP_017228629.1 PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Daucus carota subsp. sativus] XP_017228637.1 PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Daucus carota subsp. sativus] XP_017228640.1 PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Daucus carota subsp. sativus] XP_017228644.1 PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Daucus carota subsp. sativus] XP_017228650.1 PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Daucus carota subsp. sativus] XP_017228655.1 PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Daucus carota subsp. sativus] Length = 826 Score = 105 bits (263), Expect = 7e-24 Identities = 51/74 (68%), Positives = 56/74 (75%), Gaps = 6/74 (8%) Frame = +1 Query: 211 MFYSFYSLCRTRKVLENCCKLS------SCIRPFSCEGVCAHFSTRSWQNFSGNSCFDAN 372 MF+ F SLCRTRKVL NCCK+S S I PF CEGVCA+FST SW+N +S FDAN Sbjct: 1 MFFRFNSLCRTRKVLVNCCKVSIECCESSLISPFHCEGVCAYFSTNSWRNSCESSRFDAN 60 Query: 373 VCTQLVDKDDFDGG 414 VC QLVDKDDFDGG Sbjct: 61 VCAQLVDKDDFDGG 74