BLASTX nr result
ID: Angelica27_contig00039983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00039983 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017256340.1 PREDICTED: uncharacterized protein LOC108225896 [... 61 1e-08 >XP_017256340.1 PREDICTED: uncharacterized protein LOC108225896 [Daucus carota subsp. sativus] Length = 290 Score = 60.8 bits (146), Expect = 1e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 116 ISTPHMKVKFPTSMGPGELKSDSQVSRSCYSASLSLAQ 3 ISTPHMKVKFPT+ G GEL SD SRSCY+AS+SLAQ Sbjct: 231 ISTPHMKVKFPTANGSGELVSDHWASRSCYAASISLAQ 268