BLASTX nr result
ID: Angelica27_contig00039943
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00039943 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO96427.1 hypothetical protein COLO4_15282 [Corchorus olitorius] 53 9e-06 >OMO96427.1 hypothetical protein COLO4_15282 [Corchorus olitorius] Length = 319 Score = 52.8 bits (125), Expect = 9e-06 Identities = 31/64 (48%), Positives = 44/64 (68%) Frame = -1 Query: 305 LCRLLVLILQDK*HLLLINMSLRDGSLILFQVGVSDKGHALRRKLNKIAEIPDTSTLNGL 126 L R+L+ ILQDK + + + R S+I QVG+S +L+R+LN+IAE+ DTST GL Sbjct: 114 LVRVLLKILQDKLNTSVPTATERT-SVIKLQVGLSGMARSLQRQLNRIAEVADTSTSKGL 172 Query: 125 NYVL 114 +YVL Sbjct: 173 SYVL 176