BLASTX nr result
ID: Angelica27_contig00039918
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00039918 (201 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017248351.1 PREDICTED: putative cyclic nucleotide-gated ion c... 135 2e-35 KZM97113.1 hypothetical protein DCAR_015525 [Daucus carota subsp... 135 2e-35 XP_017249471.1 PREDICTED: putative cyclic nucleotide-gated ion c... 126 3e-32 XP_019199590.1 PREDICTED: protein CNGC15b-like [Ipomoea nil] 124 1e-31 CDP07094.1 unnamed protein product [Coffea canephora] 122 4e-31 XP_016483627.1 PREDICTED: putative cyclic nucleotide-gated ion c... 122 5e-31 XP_019255416.1 PREDICTED: protein CNGC15b [Nicotiana attenuata] ... 122 6e-31 XP_009788225.1 PREDICTED: putative cyclic nucleotide-gated ion c... 122 6e-31 XP_009611941.1 PREDICTED: protein CNGC15b-like [Nicotiana toment... 122 6e-31 XP_008463957.1 PREDICTED: putative cyclic nucleotide-gated ion c... 121 1e-30 XP_008463956.1 PREDICTED: putative cyclic nucleotide-gated ion c... 121 1e-30 EOY34399.1 Cyclic nucleotide-gated channel 15 [Theobroma cacao] 121 2e-30 XP_004291702.1 PREDICTED: putative cyclic nucleotide-gated ion c... 120 2e-30 XP_011657004.1 PREDICTED: putative cyclic nucleotide-gated ion c... 120 3e-30 XP_011657002.1 PREDICTED: putative cyclic nucleotide-gated ion c... 120 3e-30 KHG03806.1 hypothetical protein F383_27172 [Gossypium arboreum] 120 4e-30 XP_017640705.1 PREDICTED: putative cyclic nucleotide-gated ion c... 120 4e-30 XP_016755906.1 PREDICTED: putative cyclic nucleotide-gated ion c... 120 4e-30 XP_012471535.1 PREDICTED: putative cyclic nucleotide-gated ion c... 120 4e-30 XP_011089272.1 PREDICTED: putative cyclic nucleotide-gated ion c... 120 4e-30 >XP_017248351.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Daucus carota subsp. sativus] XP_017248352.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Daucus carota subsp. sativus] Length = 709 Score = 135 bits (339), Expect = 2e-35 Identities = 64/67 (95%), Positives = 67/67 (100%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 GRSLK+KVLSRVFSEDYERVK+KILDPRGPII+RWNKYFLVACLVSLFVDPLFFYLPVVK Sbjct: 56 GRSLKAKVLSRVFSEDYERVKKKILDPRGPIIHRWNKYFLVACLVSLFVDPLFFYLPVVK 115 Query: 21 DNLCIDI 1 DNLCIDI Sbjct: 116 DNLCIDI 122 >KZM97113.1 hypothetical protein DCAR_015525 [Daucus carota subsp. sativus] Length = 2027 Score = 135 bits (339), Expect = 2e-35 Identities = 64/67 (95%), Positives = 67/67 (100%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 GRSLK+KVLSRVFSEDYERVK+KILDPRGPII+RWNKYFLVACLVSLFVDPLFFYLPVVK Sbjct: 1374 GRSLKAKVLSRVFSEDYERVKKKILDPRGPIIHRWNKYFLVACLVSLFVDPLFFYLPVVK 1433 Query: 21 DNLCIDI 1 DNLCIDI Sbjct: 1434 DNLCIDI 1440 >XP_017249471.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Daucus carota subsp. sativus] XP_017249472.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Daucus carota subsp. sativus] XP_017249473.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Daucus carota subsp. sativus] Length = 707 Score = 126 bits (316), Expect = 3e-32 Identities = 60/67 (89%), Positives = 63/67 (94%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 GRSLK+KVL RVFSEDYERVK+KILDPRGPII RWNK FL+ACLVSLFVDPLFFYLP VK Sbjct: 53 GRSLKTKVLLRVFSEDYERVKKKILDPRGPIIRRWNKIFLIACLVSLFVDPLFFYLPGVK 112 Query: 21 DNLCIDI 1 DNLCIDI Sbjct: 113 DNLCIDI 119 >XP_019199590.1 PREDICTED: protein CNGC15b-like [Ipomoea nil] Length = 714 Score = 124 bits (311), Expect = 1e-31 Identities = 59/67 (88%), Positives = 62/67 (92%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 G+SLK+KVLSRVFSEDYERVKRKILDPRGPII RWNK FLVACLVSLFVDPLFFYLPV + Sbjct: 56 GKSLKAKVLSRVFSEDYERVKRKILDPRGPIIRRWNKIFLVACLVSLFVDPLFFYLPVFR 115 Query: 21 DNLCIDI 1 N CIDI Sbjct: 116 GNFCIDI 122 >CDP07094.1 unnamed protein product [Coffea canephora] Length = 680 Score = 122 bits (307), Expect = 4e-31 Identities = 57/67 (85%), Positives = 64/67 (95%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 G+SL++KVLSRVFSEDYERV+RKILDPRGP I RWNK FLVACLVSLFVDPLFFYLPVVK Sbjct: 56 GKSLRAKVLSRVFSEDYERVQRKILDPRGPTIRRWNKIFLVACLVSLFVDPLFFYLPVVK 115 Query: 21 DNLCIDI 1 +N+CI+I Sbjct: 116 ENVCIEI 122 >XP_016483627.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15, partial [Nicotiana tabacum] Length = 613 Score = 122 bits (306), Expect = 5e-31 Identities = 57/67 (85%), Positives = 63/67 (94%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 G+SLK+KVLSRVFSEDYERVK+KILDPRGP I RWNK FLVACLV+LFVDPLFFYLPVV+ Sbjct: 56 GKSLKAKVLSRVFSEDYERVKKKILDPRGPTIRRWNKIFLVACLVALFVDPLFFYLPVVQ 115 Query: 21 DNLCIDI 1 D +CIDI Sbjct: 116 DKVCIDI 122 >XP_019255416.1 PREDICTED: protein CNGC15b [Nicotiana attenuata] XP_019255417.1 PREDICTED: protein CNGC15b [Nicotiana attenuata] OIS96583.1 putative cyclic nucleotide-gated ion channel 15 [Nicotiana attenuata] Length = 710 Score = 122 bits (306), Expect = 6e-31 Identities = 57/67 (85%), Positives = 63/67 (94%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 G+SLK+KVLSRVFSEDYERVK+KILDPRGP I RWNK FLVACLV+LFVDPLFFYLPVV+ Sbjct: 56 GKSLKAKVLSRVFSEDYERVKKKILDPRGPTIRRWNKIFLVACLVALFVDPLFFYLPVVQ 115 Query: 21 DNLCIDI 1 D +CIDI Sbjct: 116 DKVCIDI 122 >XP_009788225.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Nicotiana sylvestris] Length = 710 Score = 122 bits (306), Expect = 6e-31 Identities = 57/67 (85%), Positives = 63/67 (94%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 G+SLK+KVLSRVFSEDYERVK+KILDPRGP I RWNK FLVACLV+LFVDPLFFYLPVV+ Sbjct: 56 GKSLKAKVLSRVFSEDYERVKKKILDPRGPTIRRWNKIFLVACLVALFVDPLFFYLPVVQ 115 Query: 21 DNLCIDI 1 D +CIDI Sbjct: 116 DKVCIDI 122 >XP_009611941.1 PREDICTED: protein CNGC15b-like [Nicotiana tomentosiformis] XP_016453101.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Nicotiana tabacum] XP_018629387.1 PREDICTED: protein CNGC15b-like [Nicotiana tomentosiformis] Length = 710 Score = 122 bits (306), Expect = 6e-31 Identities = 57/67 (85%), Positives = 63/67 (94%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 G+SLK+KVLSRVFSEDYERVK+KILDPRGP I RWNK FLVACLV+LFVDPLFFYLPVV+ Sbjct: 56 GKSLKAKVLSRVFSEDYERVKKKILDPRGPTIRRWNKIFLVACLVALFVDPLFFYLPVVQ 115 Query: 21 DNLCIDI 1 D +CIDI Sbjct: 116 DKVCIDI 122 >XP_008463957.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X2 [Cucumis melo] XP_008463958.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X2 [Cucumis melo] Length = 700 Score = 121 bits (304), Expect = 1e-30 Identities = 56/67 (83%), Positives = 63/67 (94%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 GRSL++KVLSRVFSEDYERV+RKILDPRG +I RWNK FLVACL+SLFVDPLFFYLPVV+ Sbjct: 55 GRSLRAKVLSRVFSEDYERVQRKILDPRGQVIRRWNKIFLVACLISLFVDPLFFYLPVVR 114 Query: 21 DNLCIDI 1 D +CIDI Sbjct: 115 DKVCIDI 121 >XP_008463956.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X1 [Cucumis melo] Length = 723 Score = 121 bits (304), Expect = 1e-30 Identities = 56/67 (83%), Positives = 63/67 (94%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 GRSL++KVLSRVFSEDYERV+RKILDPRG +I RWNK FLVACL+SLFVDPLFFYLPVV+ Sbjct: 78 GRSLRAKVLSRVFSEDYERVQRKILDPRGQVIRRWNKIFLVACLISLFVDPLFFYLPVVR 137 Query: 21 DNLCIDI 1 D +CIDI Sbjct: 138 DKVCIDI 144 >EOY34399.1 Cyclic nucleotide-gated channel 15 [Theobroma cacao] Length = 708 Score = 121 bits (303), Expect = 2e-30 Identities = 58/67 (86%), Positives = 62/67 (92%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 GRSLK+KVLSRVFSED+ERVK+KILDPRGPII RWNK FLVACLVSLFVDPLFFYLPVV Sbjct: 58 GRSLKTKVLSRVFSEDFERVKKKILDPRGPIIRRWNKIFLVACLVSLFVDPLFFYLPVVS 117 Query: 21 DNLCIDI 1 +CIDI Sbjct: 118 KAVCIDI 124 >XP_004291702.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Fragaria vesca subsp. vesca] Length = 704 Score = 120 bits (302), Expect = 2e-30 Identities = 56/67 (83%), Positives = 61/67 (91%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 G+SLK+KVLSRVFSEDYERVK+KILDPRGP I RWNK FLV CL+SLFVDPLFFYLP VK Sbjct: 57 GKSLKAKVLSRVFSEDYERVKKKILDPRGPTIRRWNKIFLVTCLISLFVDPLFFYLPEVK 116 Query: 21 DNLCIDI 1 D +CIDI Sbjct: 117 DQVCIDI 123 >XP_011657004.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X2 [Cucumis sativus] XP_011657005.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X2 [Cucumis sativus] KGN46846.1 hypothetical protein Csa_6G146420 [Cucumis sativus] Length = 700 Score = 120 bits (301), Expect = 3e-30 Identities = 56/67 (83%), Positives = 62/67 (92%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 GRSL++KVLSRVFSEDYERV+RKILDPRG +I RWNK FLVACLVSLFVDPLFFYLP V+ Sbjct: 55 GRSLRAKVLSRVFSEDYERVQRKILDPRGQVIRRWNKIFLVACLVSLFVDPLFFYLPAVR 114 Query: 21 DNLCIDI 1 D +CIDI Sbjct: 115 DKVCIDI 121 >XP_011657002.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X1 [Cucumis sativus] XP_011657003.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 isoform X1 [Cucumis sativus] Length = 723 Score = 120 bits (301), Expect = 3e-30 Identities = 56/67 (83%), Positives = 62/67 (92%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 GRSL++KVLSRVFSEDYERV+RKILDPRG +I RWNK FLVACLVSLFVDPLFFYLP V+ Sbjct: 78 GRSLRAKVLSRVFSEDYERVQRKILDPRGQVIRRWNKIFLVACLVSLFVDPLFFYLPAVR 137 Query: 21 DNLCIDI 1 D +CIDI Sbjct: 138 DKVCIDI 144 >KHG03806.1 hypothetical protein F383_27172 [Gossypium arboreum] Length = 686 Score = 120 bits (300), Expect = 4e-30 Identities = 55/67 (82%), Positives = 63/67 (94%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 G+ LK+KVLSRVFSED+ERVK+KILDPRGP+I RWNK FLVACLVSLFVDPLFFYLP+VK Sbjct: 37 GKLLKAKVLSRVFSEDFERVKKKILDPRGPVIRRWNKIFLVACLVSLFVDPLFFYLPIVK 96 Query: 21 DNLCIDI 1 ++CIDI Sbjct: 97 KDVCIDI 103 >XP_017640705.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Gossypium arboreum] Length = 708 Score = 120 bits (300), Expect = 4e-30 Identities = 55/67 (82%), Positives = 63/67 (94%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 G+ LK+KVLSRVFSED+ERVK+KILDPRGP+I RWNK FLVACLVSLFVDPLFFYLP+VK Sbjct: 59 GKLLKAKVLSRVFSEDFERVKKKILDPRGPVIRRWNKIFLVACLVSLFVDPLFFYLPIVK 118 Query: 21 DNLCIDI 1 ++CIDI Sbjct: 119 KDVCIDI 125 >XP_016755906.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Gossypium hirsutum] Length = 708 Score = 120 bits (300), Expect = 4e-30 Identities = 55/67 (82%), Positives = 63/67 (94%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 G+ LK+KVLSRVFSED+ERVK+KILDPRGP+I RWNK FLVACLVSLFVDPLFFYLP+VK Sbjct: 59 GKLLKAKVLSRVFSEDFERVKKKILDPRGPVIRRWNKIFLVACLVSLFVDPLFFYLPIVK 118 Query: 21 DNLCIDI 1 ++CIDI Sbjct: 119 KDVCIDI 125 >XP_012471535.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Gossypium raimondii] XP_016753874.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Gossypium hirsutum] KJB20312.1 hypothetical protein B456_003G143300 [Gossypium raimondii] Length = 708 Score = 120 bits (300), Expect = 4e-30 Identities = 55/67 (82%), Positives = 63/67 (94%) Frame = -1 Query: 201 GRSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVK 22 G+ LK+KVLSRVFSED+ERVK+KILDPRGP+I RWNK FLVACLVSLFVDPLFFYLP+VK Sbjct: 59 GKLLKAKVLSRVFSEDFERVKKKILDPRGPVIRRWNKIFLVACLVSLFVDPLFFYLPIVK 118 Query: 21 DNLCIDI 1 ++CIDI Sbjct: 119 KDVCIDI 125 >XP_011089272.1 PREDICTED: putative cyclic nucleotide-gated ion channel 15 [Sesamum indicum] Length = 713 Score = 120 bits (300), Expect = 4e-30 Identities = 55/66 (83%), Positives = 62/66 (93%) Frame = -1 Query: 198 RSLKSKVLSRVFSEDYERVKRKILDPRGPIINRWNKYFLVACLVSLFVDPLFFYLPVVKD 19 +SLK+KVLSRVFSEDYERVK+KILDPRGP + RWNK FL+ACLVSLFVDPLFFYLPVVK Sbjct: 57 KSLKAKVLSRVFSEDYERVKKKILDPRGPTVRRWNKIFLIACLVSLFVDPLFFYLPVVKK 116 Query: 18 NLCIDI 1 ++CIDI Sbjct: 117 DICIDI 122