BLASTX nr result
ID: Angelica27_contig00039799
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00039799 (281 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017251699.1 PREDICTED: non-specific lipid-transfer protein-li... 88 1e-19 ONH93552.1 hypothetical protein PRUPE_8G237900 [Prunus persica] 62 7e-10 XP_008235392.1 PREDICTED: non-specific lipid-transfer protein-li... 61 2e-09 XP_008235391.1 PREDICTED: non-specific lipid-transfer protein-li... 61 2e-09 KHN03811.1 Non-specific lipid-transfer protein-like protein [Gly... 61 2e-09 NP_001238368.1 uncharacterized protein LOC100306151 precursor [G... 61 2e-09 XP_004292575.1 PREDICTED: non-specific lipid-transfer protein-li... 60 6e-09 XP_007144649.1 hypothetical protein PHAVU_007G173500g [Phaseolus... 59 9e-09 XP_004290617.1 PREDICTED: non-specific lipid-transfer protein-li... 59 1e-08 XP_011458582.1 PREDICTED: non-specific lipid-transfer protein-li... 59 1e-08 XP_010086611.1 Non-specific lipid-transfer protein-like protein ... 59 2e-08 XP_018856157.1 PREDICTED: non-specific lipid-transfer protein-li... 58 2e-08 XP_018856150.1 PREDICTED: non-specific lipid-transfer protein-li... 58 3e-08 XP_008386477.1 PREDICTED: non-specific lipid-transfer protein-li... 58 3e-08 XP_015386252.1 PREDICTED: non-specific lipid-transfer protein-li... 57 9e-08 KDO68680.1 hypothetical protein CISIN_1g030070mg [Citrus sinensis] 57 9e-08 XP_012092205.1 PREDICTED: non-specific lipid-transfer protein-li... 56 2e-07 XP_009367612.1 PREDICTED: non-specific lipid-transfer protein-li... 55 5e-07 XP_010256112.1 PREDICTED: non-specific lipid-transfer protein-li... 55 6e-07 XP_009367611.1 PREDICTED: non-specific lipid-transfer protein-li... 55 6e-07 >XP_017251699.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Daucus carota subsp. sativus] KZM95192.1 hypothetical protein DCAR_018434 [Daucus carota subsp. sativus] Length = 191 Score = 87.8 bits (216), Expect = 1e-19 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +1 Query: 76 ESNNPSGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 +SN+PSG GSKTVPSTDGT S GGNIKVPVHIVLFALFIASCASAA+KF Sbjct: 143 DSNDPSGGGSKTVPSTDGTTSAGGNIKVPVHIVLFALFIASCASAASKF 191 >ONH93552.1 hypothetical protein PRUPE_8G237900 [Prunus persica] Length = 195 Score = 62.4 bits (150), Expect = 7e-10 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = +1 Query: 91 SGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 SGEGSKTVPST+G SDG NIK P+H V LF+ SCAS T F Sbjct: 152 SGEGSKTVPSTNGNTSDGSNIKAPLHFVPLLLFVISCASTLTSF 195 >XP_008235392.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 isoform X2 [Prunus mume] Length = 189 Score = 61.2 bits (147), Expect = 2e-09 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = +1 Query: 79 SNNPSGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 S + +GEGSKTVPST G SDG NIK P+H V LF+ SCAS T F Sbjct: 142 SPSATGEGSKTVPSTKGNTSDGSNIKAPLHFVPLLLFVISCASTLTSF 189 >XP_008235391.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 isoform X1 [Prunus mume] Length = 190 Score = 61.2 bits (147), Expect = 2e-09 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = +1 Query: 79 SNNPSGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 S + +GEGSKTVPST G SDG NIK P+H V LF+ SCAS T F Sbjct: 143 SPSATGEGSKTVPSTKGNTSDGSNIKAPLHFVPLLLFVISCASTLTSF 190 >KHN03811.1 Non-specific lipid-transfer protein-like protein [Glycine soja] KRH32036.1 hypothetical protein GLYMA_10G028100 [Glycine max] Length = 186 Score = 60.8 bits (146), Expect = 2e-09 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = +1 Query: 88 PSGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 PSG GSKTVPS DG SDG IKVP H+VL+ L + SCA TKF Sbjct: 142 PSGAGSKTVPSIDGGSSDGSAIKVPFHLVLYLLALVSCALTFTKF 186 >NP_001238368.1 uncharacterized protein LOC100306151 precursor [Glycine max] ACU14191.1 unknown [Glycine max] Length = 186 Score = 60.8 bits (146), Expect = 2e-09 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = +1 Query: 88 PSGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 PSG GSKTVPS DG SDG IKVP H+VL+ L + SCA TKF Sbjct: 142 PSGAGSKTVPSIDGGSSDGSAIKVPFHLVLYLLALVSCALTFTKF 186 >XP_004292575.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Fragaria vesca subsp. vesca] Length = 189 Score = 59.7 bits (143), Expect = 6e-09 Identities = 31/49 (63%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +1 Query: 79 SNNPSGEGSKTVPSTDGTGSDG-GNIKVPVHIVLFALFIASCASAATKF 222 S+ P+G GSKTVP TDG SDG IK P+H VLF +F+ASCAS+ TKF Sbjct: 142 SDVPAG-GSKTVPLTDGNTSDGRSGIKAPLHFVLFLIFVASCASSVTKF 189 >XP_007144649.1 hypothetical protein PHAVU_007G173500g [Phaseolus vulgaris] ESW16643.1 hypothetical protein PHAVU_007G173500g [Phaseolus vulgaris] Length = 186 Score = 59.3 bits (142), Expect = 9e-09 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = +1 Query: 79 SNNPSGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 S+ PSG GSKTVPST+G SDG I+VP H+V + L I SCA TKF Sbjct: 139 SDFPSGAGSKTVPSTNGGSSDGNAIEVPSHLVFYLLAIVSCALTFTKF 186 >XP_004290617.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 isoform X2 [Fragaria vesca subsp. vesca] Length = 195 Score = 58.9 bits (141), Expect = 1e-08 Identities = 30/49 (61%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +1 Query: 79 SNNPSGEGSKTVPSTD-GTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 S+ PS GSKTVPSTD G SDG +IK P++ VLF +F+ SCAS+ TKF Sbjct: 147 SDVPSTGGSKTVPSTDDGNTSDGSSIKAPLNFVLFLIFVISCASSFTKF 195 >XP_011458582.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 isoform X1 [Fragaria vesca subsp. vesca] Length = 196 Score = 58.9 bits (141), Expect = 1e-08 Identities = 30/49 (61%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +1 Query: 79 SNNPSGEGSKTVPSTD-GTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 S+ PS GSKTVPSTD G SDG +IK P++ VLF +F+ SCAS+ TKF Sbjct: 148 SDVPSTGGSKTVPSTDDGNTSDGSSIKAPLNFVLFLIFVISCASSFTKF 196 >XP_010086611.1 Non-specific lipid-transfer protein-like protein [Morus notabilis] EXB22122.1 Non-specific lipid-transfer protein-like protein [Morus notabilis] Length = 189 Score = 58.5 bits (140), Expect = 2e-08 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = +1 Query: 76 ESNNPSGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 E + P G GSK+VPST+G+ SDG N+K P+ VLF LF SC+S T F Sbjct: 141 EPDVPLGGGSKSVPSTEGSSSDGSNVKAPLRFVLFLLFTLSCSSTLTIF 189 >XP_018856157.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 isoform X2 [Juglans regia] Length = 182 Score = 58.2 bits (139), Expect = 2e-08 Identities = 27/48 (56%), Positives = 33/48 (68%) Frame = +1 Query: 79 SNNPSGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 S+ PSG GSKT+PS DG SDG +IK P+H++L LF SCAS F Sbjct: 135 SDIPSGSGSKTIPSIDGGKSDGSSIKAPLHLMLSLLFTVSCASTIITF 182 >XP_018856150.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 isoform X1 [Juglans regia] Length = 194 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/48 (56%), Positives = 33/48 (68%) Frame = +1 Query: 79 SNNPSGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 S+ PSG GSKT+PS DG SDG +IK P+H++L LF SCAS F Sbjct: 147 SDIPSGSGSKTIPSIDGGKSDGSSIKAPLHLMLSLLFTVSCASTIITF 194 >XP_008386477.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Malus domestica] Length = 194 Score = 58.2 bits (139), Expect = 3e-08 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +1 Query: 91 SGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 SG GSKTVPST+G SDG + P+H VLF +F+ SCAS+ KF Sbjct: 151 SGGGSKTVPSTNGNTSDGSTSRAPLHFVLFLVFVMSCASSLAKF 194 >XP_015386252.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Citrus sinensis] Length = 183 Score = 56.6 bits (135), Expect = 9e-08 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = +1 Query: 88 PSGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATK 219 PSG GSKTVP+ DG+ S G I +P+H +F LF+ASC S+A K Sbjct: 139 PSGSGSKTVPTADGSSSSGSIITMPLHFTVFILFLASCFSSAIK 182 >KDO68680.1 hypothetical protein CISIN_1g030070mg [Citrus sinensis] Length = 183 Score = 56.6 bits (135), Expect = 9e-08 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = +1 Query: 88 PSGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATK 219 PSG GSKTVP+ DG+ S G I +P+H +F LF+ASC S+A K Sbjct: 139 PSGSGSKTVPTADGSSSSGSIITMPLHFTVFILFLASCFSSAIK 182 >XP_012092205.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Jatropha curcas] KDP21428.1 hypothetical protein JCGZ_21899 [Jatropha curcas] Length = 204 Score = 56.2 bits (134), Expect = 2e-07 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = +1 Query: 82 NNPSGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 ++ SG GSKTVPST+GT SDG K P+H++LFA FI C SA +KF Sbjct: 159 SSSSGSGSKTVPSTNGT-SDGSIRKAPIHLMLFAFFILWCGSAFSKF 204 >XP_009367612.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 isoform X2 [Pyrus x bretschneideri] Length = 194 Score = 54.7 bits (130), Expect = 5e-07 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = +1 Query: 91 SGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 SG GSKTVPS++G S+G + P+H VLF F+ SCAS+ +KF Sbjct: 151 SGGGSKTVPSSNGNTSNGSTSRAPLHFVLFLFFVMSCASSLSKF 194 >XP_010256112.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Nelumbo nucifera] Length = 203 Score = 54.7 bits (130), Expect = 6e-07 Identities = 27/48 (56%), Positives = 31/48 (64%) Frame = +1 Query: 79 SNNPSGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 S P+G GSKTVPST G S G + K P+ +V F LF ASCAS T F Sbjct: 156 STIPAGAGSKTVPSTTGVVSHGSSTKKPLQLVFFLLFTASCASTFTSF 203 >XP_009367611.1 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 isoform X1 [Pyrus x bretschneideri] Length = 212 Score = 54.7 bits (130), Expect = 6e-07 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = +1 Query: 91 SGEGSKTVPSTDGTGSDGGNIKVPVHIVLFALFIASCASAATKF 222 SG GSKTVPS++G S+G + P+H VLF F+ SCAS+ +KF Sbjct: 169 SGGGSKTVPSSNGNTSNGSTSRAPLHFVLFLFFVMSCASSLSKF 212