BLASTX nr result
ID: Angelica27_contig00039631
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00039631 (362 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_064004.1 orf107b gene product (mitochondrion) [Beta vulgaris ... 83 2e-18 OIT04243.1 hypothetical protein A4A49_22702 [Nicotiana attenuata] 68 9e-13 >NP_064004.1 orf107b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] YP_004222369.1 hypothetical protein BevumaM_p136 (mitochondrion) [Beta vulgaris subsp. maritima] YP_004842174.1 hypothetical protein BemaM_p130 (mitochondrion) [Beta macrocarpa] BAA99316.1 orf107b (mitochondrion) [Beta vulgaris subsp. vulgaris] CBJ14008.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ17584.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ20702.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBX24979.1 hypothetical protein (mitochondrion) [Beta macrocarpa] CBL54138.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 107 Score = 83.2 bits (204), Expect = 2e-18 Identities = 53/73 (72%), Positives = 57/73 (78%) Frame = +3 Query: 3 RIRLAQRLLNPSRAFFFYSTSPLQSSIKLAFPRR*LNGGLSFSPIVCIGLASSRTREAFL 182 RIRLAQRLLNPSRA F ST PLQSSIKLAF RR G+ SPIVCIGLASSR++ +L Sbjct: 39 RIRLAQRLLNPSRA--FSSTFPLQSSIKLAFSRR-SEMGVFPSPIVCIGLASSRSK-LYL 94 Query: 183 RARACRKAGGSIS 221 RARACRKA IS Sbjct: 95 RARACRKADHYIS 107 >OIT04243.1 hypothetical protein A4A49_22702 [Nicotiana attenuata] Length = 81 Score = 68.2 bits (165), Expect = 9e-13 Identities = 37/64 (57%), Positives = 43/64 (67%) Frame = -1 Query: 242 ACSRSLLAYGAAGLPTRARPQECLPGSGRSQADTYDRRKGKTPI*LAPGERKFYRGLERR 63 +CS SLLAY LP RP ECL GSGR QADTY+R + + P +AP ERKF GLE+R Sbjct: 17 SCSNSLLAYVVVELPALIRPPECLLGSGRRQADTYNRGR-EDPYFIAPEERKFDGGLEKR 75 Query: 62 GGIK 51 G K Sbjct: 76 DGRK 79