BLASTX nr result
ID: Angelica27_contig00039531
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00039531 (266 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017256946.1 PREDICTED: homeobox-leucine zipper protein HOX11 ... 62 1e-09 >XP_017256946.1 PREDICTED: homeobox-leucine zipper protein HOX11 [Daucus carota subsp. sativus] KZM92786.1 hypothetical protein DCAR_019849 [Daucus carota subsp. sativus] Length = 297 Score = 62.4 bits (150), Expect = 1e-09 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +2 Query: 149 MELGLSLGETQK-PFKLFGKTNEMVVKKDHGVGFCMGLA 262 MELGLSLGETQK PF+LFGK+NE V K D G+GFCMGLA Sbjct: 1 MELGLSLGETQKQPFRLFGKSNETVKKLDDGLGFCMGLA 39