BLASTX nr result
ID: Angelica27_contig00039476
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00039476 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM92498.1 hypothetical protein DCAR_020137 [Daucus carota subsp... 82 5e-16 XP_017255618.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 5e-14 >KZM92498.1 hypothetical protein DCAR_020137 [Daucus carota subsp. sativus] Length = 475 Score = 82.0 bits (201), Expect = 5e-16 Identities = 39/54 (72%), Positives = 44/54 (81%) Frame = +3 Query: 159 SFSKMLIRARLYFYERILNVTKSNAVVSRSFGTSMKPVLKDNEGNTFRGGGGVS 320 SF KML+RARL FYER+LNVT++NAVV RSFG PV KDNEG+ RGGGGVS Sbjct: 4 SFEKMLVRARLCFYERVLNVTRANAVVYRSFGAMTSPVFKDNEGSKVRGGGGVS 57 >XP_017255618.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Daucus carota subsp. sativus] XP_017255619.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Daucus carota subsp. sativus] Length = 468 Score = 76.3 bits (186), Expect = 5e-14 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = +3 Query: 171 MLIRARLYFYERILNVTKSNAVVSRSFGTSMKPVLKDNEGNTFRGGGGVS 320 ML+RARL FYER+LNVT++NAVV RSFG PV KDNEG+ RGGGGVS Sbjct: 1 MLVRARLCFYERVLNVTRANAVVYRSFGAMTSPVFKDNEGSKVRGGGGVS 50