BLASTX nr result
ID: Angelica27_contig00039473
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00039473 (425 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN09851.1 hypothetical protein DCAR_002507 [Daucus carota subsp... 58 4e-07 XP_017229252.1 PREDICTED: PH-interacting protein [Daucus carota ... 58 4e-07 >KZN09851.1 hypothetical protein DCAR_002507 [Daucus carota subsp. sativus] Length = 1716 Score = 58.2 bits (139), Expect = 4e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 110 MALQKYSPSADAPSTNMKSLRFSRKSNEKTQSAVTE 3 MALQK SPSADAPS NMKSL+ SRKSNEK+Q VTE Sbjct: 1 MALQKCSPSADAPSANMKSLKLSRKSNEKSQLVVTE 36 >XP_017229252.1 PREDICTED: PH-interacting protein [Daucus carota subsp. sativus] Length = 1725 Score = 58.2 bits (139), Expect = 4e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 110 MALQKYSPSADAPSTNMKSLRFSRKSNEKTQSAVTE 3 MALQK SPSADAPS NMKSL+ SRKSNEK+Q VTE Sbjct: 1 MALQKCSPSADAPSANMKSLKLSRKSNEKSQLVVTE 36