BLASTX nr result
ID: Angelica27_contig00039447
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00039447 (304 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABK22344.1 unknown [Picea sitchensis] 61 8e-09 >ABK22344.1 unknown [Picea sitchensis] Length = 293 Score = 60.8 bits (146), Expect = 8e-09 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 5/52 (9%) Frame = -1 Query: 304 GTLSQASKGPPKDMEV-----WEEEKSEMPKHCPGPCECCFPPYSLLLSPDD 164 G+L++A KG P ++E + EK EMP HC PC CCFPP+S+LL P+D Sbjct: 237 GSLAEACKGAPSNLEKELDEEFNGEKLEMPSHCSEPCNCCFPPFSVLLRPED 288