BLASTX nr result
ID: Angelica27_contig00039432
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00039432 (288 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO69602.1 hypothetical protein CISIN_1g023127mg [Citrus sinensis] 56 2e-07 XP_017252327.1 PREDICTED: anthranilate phosphoribosyltransferase... 55 1e-06 KZM93234.1 hypothetical protein DCAR_016479 [Daucus carota subsp... 55 1e-06 XP_011071889.1 PREDICTED: anthranilate phosphoribosyltransferase... 54 2e-06 KDO69598.1 hypothetical protein CISIN_1g023127mg [Citrus sinensi... 53 3e-06 ANS59490.1 anthranilate phosphoribosyltransferase, partial [Taxo... 54 3e-06 GAV58362.1 Glycos_transf_3 domain-containing protein/Glycos_tran... 54 3e-06 XP_012855698.1 PREDICTED: anthranilate phosphoribosyltransferase... 54 3e-06 KDO69601.1 hypothetical protein CISIN_1g023127mg [Citrus sinensis] 53 4e-06 XP_019175440.1 PREDICTED: anthranilate phosphoribosyltransferase... 53 5e-06 KDO69600.1 hypothetical protein CISIN_1g023127mg [Citrus sinensis] 53 5e-06 KDO69595.1 hypothetical protein CISIN_1g023127mg [Citrus sinensis] 53 5e-06 KDO69597.1 hypothetical protein CISIN_1g023127mg [Citrus sinensis] 53 5e-06 KDO69596.1 hypothetical protein CISIN_1g023127mg [Citrus sinensis] 53 6e-06 XP_015385310.1 PREDICTED: anthranilate phosphoribosyltransferase... 53 6e-06 XP_006476804.1 PREDICTED: anthranilate phosphoribosyltransferase... 53 6e-06 XP_015385309.1 PREDICTED: anthranilate phosphoribosyltransferase... 53 6e-06 XP_006439848.1 hypothetical protein CICLE_v10020016mg [Citrus cl... 53 6e-06 XP_006439849.1 hypothetical protein CICLE_v10020016mg [Citrus cl... 53 6e-06 XP_006439846.1 hypothetical protein CICLE_v10020016mg [Citrus cl... 53 6e-06 >KDO69602.1 hypothetical protein CISIN_1g023127mg [Citrus sinensis] Length = 219 Score = 56.2 bits (134), Expect = 2e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNYLTSFLISF 178 DEMSPLGPGL+LDVT +KIE+F FDPC L + L F Sbjct: 163 DEMSPLGPGLILDVTQEKIERFSFDPCKDLVTDLFYF 199 >XP_017252327.1 PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like [Daucus carota subsp. sativus] Length = 406 Score = 55.1 bits (131), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGLVLDVTSDKIEKF FDP ++ Sbjct: 283 DEMSPLGPGLVLDVTSDKIEKFLFDPLDF 311 >KZM93234.1 hypothetical protein DCAR_016479 [Daucus carota subsp. sativus] Length = 414 Score = 55.1 bits (131), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGLVLDVTSDKIEKF FDP ++ Sbjct: 291 DEMSPLGPGLVLDVTSDKIEKFLFDPLDF 319 >XP_011071889.1 PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like [Sesamum indicum] Length = 409 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGLVLDVT DKIEKF FDP ++ Sbjct: 286 DEMSPLGPGLVLDVTPDKIEKFSFDPLDF 314 >KDO69598.1 hypothetical protein CISIN_1g023127mg [Citrus sinensis] KDO69599.1 hypothetical protein CISIN_1g023127mg [Citrus sinensis] Length = 193 Score = 52.8 bits (125), Expect = 3e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGL+LDVT +KIE+F FDP +Y Sbjct: 75 DEMSPLGPGLILDVTQEKIERFSFDPLDY 103 >ANS59490.1 anthranilate phosphoribosyltransferase, partial [Taxodium distichum x Taxodium mucronatum] Length = 340 Score = 53.5 bits (127), Expect = 3e-06 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPG++LDVT+DKIEKF FDP ++ Sbjct: 289 DEMSPLGPGIILDVTADKIEKFSFDPLDF 317 >GAV58362.1 Glycos_transf_3 domain-containing protein/Glycos_trans_3N domain-containing protein [Cephalotus follicularis] Length = 404 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGLVLDVT DKIEKF FDP + Sbjct: 290 DEMSPLGPGLVLDVTPDKIEKFSFDPVEF 318 >XP_012855698.1 PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like [Erythranthe guttata] EYU22141.1 hypothetical protein MIMGU_mgv1a007249mg [Erythranthe guttata] Length = 413 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGLVLDVT DKIEKF FDP + Sbjct: 289 DEMSPLGPGLVLDVTPDKIEKFSFDPLEF 317 >KDO69601.1 hypothetical protein CISIN_1g023127mg [Citrus sinensis] Length = 233 Score = 52.8 bits (125), Expect = 4e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGL+LDVT +KIE+F FDP +Y Sbjct: 163 DEMSPLGPGLILDVTQEKIERFSFDPLDY 191 >XP_019175440.1 PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like [Ipomoea nil] Length = 413 Score = 53.1 bits (126), Expect = 5e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGL++DVT KIEKFPFDP ++ Sbjct: 289 DEMSPLGPGLIVDVTPSKIEKFPFDPLDF 317 >KDO69600.1 hypothetical protein CISIN_1g023127mg [Citrus sinensis] Length = 279 Score = 52.8 bits (125), Expect = 5e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGL+LDVT +KIE+F FDP +Y Sbjct: 163 DEMSPLGPGLILDVTQEKIERFSFDPLDY 191 >KDO69595.1 hypothetical protein CISIN_1g023127mg [Citrus sinensis] Length = 279 Score = 52.8 bits (125), Expect = 5e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGL+LDVT +KIE+F FDP +Y Sbjct: 163 DEMSPLGPGLILDVTQEKIERFSFDPLDY 191 >KDO69597.1 hypothetical protein CISIN_1g023127mg [Citrus sinensis] Length = 281 Score = 52.8 bits (125), Expect = 5e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGL+LDVT +KIE+F FDP +Y Sbjct: 163 DEMSPLGPGLILDVTQEKIERFSFDPLDY 191 >KDO69596.1 hypothetical protein CISIN_1g023127mg [Citrus sinensis] Length = 287 Score = 52.8 bits (125), Expect = 6e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGL+LDVT +KIE+F FDP +Y Sbjct: 163 DEMSPLGPGLILDVTQEKIERFSFDPLDY 191 >XP_015385310.1 PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic isoform X3 [Citrus sinensis] Length = 413 Score = 52.8 bits (125), Expect = 6e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGL+LDVT +KIE+F FDP +Y Sbjct: 295 DEMSPLGPGLILDVTQEKIERFSFDPLDY 323 >XP_006476804.1 PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic isoform X2 [Citrus sinensis] Length = 413 Score = 52.8 bits (125), Expect = 6e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGL+LDVT +KIE+F FDP +Y Sbjct: 295 DEMSPLGPGLILDVTQEKIERFSFDPLDY 323 >XP_015385309.1 PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic isoform X1 [Citrus sinensis] Length = 419 Score = 52.8 bits (125), Expect = 6e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGL+LDVT +KIE+F FDP +Y Sbjct: 295 DEMSPLGPGLILDVTQEKIERFSFDPLDY 323 >XP_006439848.1 hypothetical protein CICLE_v10020016mg [Citrus clementina] ESR53088.1 hypothetical protein CICLE_v10020016mg [Citrus clementina] Length = 422 Score = 52.8 bits (125), Expect = 6e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGL+LDVT +KIE+F FDP +Y Sbjct: 352 DEMSPLGPGLILDVTQEKIERFSFDPLDY 380 >XP_006439849.1 hypothetical protein CICLE_v10020016mg [Citrus clementina] ESR53089.1 hypothetical protein CICLE_v10020016mg [Citrus clementina] Length = 468 Score = 52.8 bits (125), Expect = 6e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGL+LDVT +KIE+F FDP +Y Sbjct: 352 DEMSPLGPGLILDVTQEKIERFSFDPLDY 380 >XP_006439846.1 hypothetical protein CICLE_v10020016mg [Citrus clementina] ESR53086.1 hypothetical protein CICLE_v10020016mg [Citrus clementina] Length = 468 Score = 52.8 bits (125), Expect = 6e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 288 DEMSPLGPGLVLDVTSDKIEKFPFDPCNY 202 DEMSPLGPGL+LDVT +KIE+F FDP +Y Sbjct: 352 DEMSPLGPGLILDVTQEKIERFSFDPLDY 380