BLASTX nr result
ID: Angelica27_contig00039404
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00039404 (265 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM81845.1 hypothetical protein DCAR_029458 [Daucus carota subsp... 171 1e-48 XP_017227110.1 PREDICTED: pentatricopeptide repeat-containing pr... 171 1e-48 XP_008236408.1 PREDICTED: pentatricopeptide repeat-containing pr... 125 7e-32 XP_019074659.1 PREDICTED: pentatricopeptide repeat-containing pr... 123 1e-31 ONH91831.1 hypothetical protein PRUPE_8G138100 [Prunus persica] 124 3e-31 XP_007199641.1 hypothetical protein PRUPE_ppa021613mg [Prunus pe... 124 4e-31 XP_010647944.1 PREDICTED: pentatricopeptide repeat-containing pr... 123 5e-31 XP_014512536.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 6e-31 XP_010068395.1 PREDICTED: putative pentatricopeptide repeat-cont... 123 7e-31 XP_015574411.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 1e-30 XP_010695239.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 1e-30 XP_014512534.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 1e-30 XP_017413708.1 PREDICTED: putative pentatricopeptide repeat-cont... 121 3e-30 XP_012575253.1 PREDICTED: putative pentatricopeptide repeat-cont... 121 3e-30 XP_008455017.1 PREDICTED: pentatricopeptide repeat-containing pr... 119 4e-30 XP_007143083.1 hypothetical protein PHAVU_007G042100g [Phaseolus... 120 4e-30 XP_011088184.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 5e-30 EYU37608.1 hypothetical protein MIMGU_mgv1a006142mg [Erythranthe... 119 5e-30 XP_004309732.2 PREDICTED: pentatricopeptide repeat-containing pr... 120 6e-30 XP_016489387.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 6e-30 >KZM81845.1 hypothetical protein DCAR_029458 [Daucus carota subsp. sativus] Length = 572 Score = 171 bits (432), Expect = 1e-48 Identities = 79/87 (90%), Positives = 82/87 (94%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWGSLL GCVLHKKLEY ENISKML+RADP+NSAGYVLLSNAYASDRRWGDVSELRCFM Sbjct: 461 FVWGSLLGGCVLHKKLEYAENISKMLVRADPDNSAGYVLLSNAYASDRRWGDVSELRCFM 520 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAGS 263 KEKGVKKHS NSW+SIEG VHEF AGS Sbjct: 521 KEKGVKKHSANSWVSIEGAVHEFFAGS 547 >XP_017227110.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227112.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227113.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227114.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227115.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227116.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227118.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227119.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227120.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227121.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227122.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227124.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227125.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227126.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227127.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227128.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] XP_017227129.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Daucus carota subsp. sativus] Length = 594 Score = 171 bits (432), Expect = 1e-48 Identities = 79/87 (90%), Positives = 82/87 (94%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWGSLL GCVLHKKLEY ENISKML+RADP+NSAGYVLLSNAYASDRRWGDVSELRCFM Sbjct: 483 FVWGSLLGGCVLHKKLEYAENISKMLVRADPDNSAGYVLLSNAYASDRRWGDVSELRCFM 542 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAGS 263 KEKGVKKHS NSW+SIEG VHEF AGS Sbjct: 543 KEKGVKKHSANSWVSIEGAVHEFFAGS 569 >XP_008236408.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Prunus mume] Length = 630 Score = 125 bits (315), Expect = 7e-32 Identities = 54/86 (62%), Positives = 70/86 (81%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG+LL GC+LH +++ + +S L+R+DP+NS GY++L+NA+ASDRRWGDVS LR FM Sbjct: 519 FVWGALLGGCLLHSRVDLAQYVSNKLVRSDPDNSGGYIMLANAFASDRRWGDVSVLRWFM 578 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAG 260 +EKGV K G SWISI+G VHEFL G Sbjct: 579 REKGVTKQPGFSWISIDGVVHEFLVG 604 >XP_019074659.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic isoform X2 [Vitis vinifera] Length = 447 Score = 123 bits (309), Expect = 1e-31 Identities = 55/87 (63%), Positives = 70/87 (80%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG+LL GC LH +LE +++S+ L++ DPENSAGYV+ SNA ASD++WG+VS LR M Sbjct: 336 FVWGALLQGCRLHSRLELAQDVSQKLVKVDPENSAGYVMFSNALASDQQWGEVSGLRWLM 395 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAGS 263 +EKGV+KH G SWIS+ VHEFLAGS Sbjct: 396 REKGVRKHPGCSWISVNRVVHEFLAGS 422 >ONH91831.1 hypothetical protein PRUPE_8G138100 [Prunus persica] Length = 628 Score = 124 bits (310), Expect = 3e-31 Identities = 53/86 (61%), Positives = 69/86 (80%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG+LL GC+LH +++ + +S L+R+DP+NS GY++L+NA+ASDRRWGDVS LR M Sbjct: 517 FVWGALLGGCLLHSRVDLAQYVSNKLVRSDPDNSGGYIMLANAFASDRRWGDVSALRWVM 576 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAG 260 +EKGV K G SWISI+G VHEFL G Sbjct: 577 REKGVNKQPGCSWISIDGVVHEFLVG 602 >XP_007199641.1 hypothetical protein PRUPE_ppa021613mg [Prunus persica] Length = 643 Score = 124 bits (310), Expect = 4e-31 Identities = 53/86 (61%), Positives = 69/86 (80%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG+LL GC+LH +++ + +S L+R+DP+NS GY++L+NA+ASDRRWGDVS LR M Sbjct: 532 FVWGALLGGCLLHSRVDLAQYVSNKLVRSDPDNSGGYIMLANAFASDRRWGDVSALRWVM 591 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAG 260 +EKGV K G SWISI+G VHEFL G Sbjct: 592 REKGVNKQPGCSWISIDGVVHEFLVG 617 >XP_010647944.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230 isoform X1 [Vitis vinifera] XP_019074656.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230 isoform X1 [Vitis vinifera] XP_019074657.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230 isoform X1 [Vitis vinifera] XP_019074658.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230 isoform X1 [Vitis vinifera] Length = 630 Score = 123 bits (309), Expect = 5e-31 Identities = 55/87 (63%), Positives = 70/87 (80%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG+LL GC LH +LE +++S+ L++ DPENSAGYV+ SNA ASD++WG+VS LR M Sbjct: 519 FVWGALLQGCRLHSRLELAQDVSQKLVKVDPENSAGYVMFSNALASDQQWGEVSGLRWLM 578 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAGS 263 +EKGV+KH G SWIS+ VHEFLAGS Sbjct: 579 REKGVRKHPGCSWISVNRVVHEFLAGS 605 >XP_014512536.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like isoform X2 [Vigna radiata var. radiata] Length = 506 Score = 122 bits (306), Expect = 6e-31 Identities = 51/86 (59%), Positives = 69/86 (80%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG+LL GC+LH ++E + +S+ L+ DP+NSAGYV+L+NA+AS+ +W DVSELR M Sbjct: 388 FVWGALLGGCLLHSRVELAQEVSRRLVEVDPDNSAGYVMLANAFASENQWSDVSELRLEM 447 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAG 260 KEKG+KK G+SWI ++G VHEFL G Sbjct: 448 KEKGIKKQPGSSWIVVDGVVHEFLVG 473 >XP_010068395.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820 [Eucalyptus grandis] KCW63670.1 hypothetical protein EUGRSUZ_G01317 [Eucalyptus grandis] Length = 634 Score = 123 bits (308), Expect = 7e-31 Identities = 54/87 (62%), Positives = 71/87 (81%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG+LL GC+LH + E +++SK L++ DPENSAGYV+L+NA+A+DR+W DVS LR M Sbjct: 525 FVWGALLGGCLLHARGELAQHVSKKLVQVDPENSAGYVMLANAFAADRQWDDVSVLRWVM 584 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAGS 263 +E+GVKK G+SWI I+G VHEFL GS Sbjct: 585 RERGVKKQPGHSWIQIDGIVHEFLVGS 611 >XP_015574411.1 PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Ricinus communis] Length = 670 Score = 122 bits (307), Expect = 1e-30 Identities = 56/87 (64%), Positives = 66/87 (75%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG+LL GC+LH K+E +NI K L+ DPENSAGYV+L+N +A D +W DVS LR M Sbjct: 559 FVWGALLGGCLLHSKVELAKNIYKRLVEVDPENSAGYVMLANVFAVDHQWSDVSALRWLM 618 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAGS 263 +EKGVKK G SWISI G VHEFL GS Sbjct: 619 REKGVKKQPGCSWISINGIVHEFLVGS 645 >XP_010695239.1 PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Beta vulgaris subsp. vulgaris] KMS97816.1 hypothetical protein BVRB_5g123780 [Beta vulgaris subsp. vulgaris] Length = 602 Score = 122 bits (306), Expect = 1e-30 Identities = 57/86 (66%), Positives = 69/86 (80%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG+LL GC LH + + ++ISK LI DP+NSAGY++LSN AS++ WG+VS LR FM Sbjct: 492 FVWGALLGGCSLHFRGKLTQDISKRLIEVDPQNSAGYIMLSNVLASEQEWGEVSGLRRFM 551 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAG 260 KEKGVKKH G SWISI+G VHEFLAG Sbjct: 552 KEKGVKKHRGCSWISIDGLVHEFLAG 577 >XP_014512534.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like isoform X1 [Vigna radiata var. radiata] XP_014512535.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like isoform X1 [Vigna radiata var. radiata] Length = 632 Score = 122 bits (306), Expect = 1e-30 Identities = 51/86 (59%), Positives = 69/86 (80%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG+LL GC+LH ++E + +S+ L+ DP+NSAGYV+L+NA+AS+ +W DVSELR M Sbjct: 514 FVWGALLGGCLLHSRVELAQEVSRRLVEVDPDNSAGYVMLANAFASENQWSDVSELRLEM 573 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAG 260 KEKG+KK G+SWI ++G VHEFL G Sbjct: 574 KEKGIKKQPGSSWIVVDGVVHEFLVG 599 >XP_017413708.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820 [Vigna angularis] XP_017413709.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820 [Vigna angularis] KOM36242.1 hypothetical protein LR48_Vigan02g239200 [Vigna angularis] BAT93920.1 hypothetical protein VIGAN_08047300 [Vigna angularis var. angularis] Length = 632 Score = 121 bits (303), Expect = 3e-30 Identities = 51/86 (59%), Positives = 68/86 (79%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG+LL GC+LH ++E + +S+ L+ DP+NSAGYV+L+NA+AS +W DVSELR M Sbjct: 514 FVWGALLGGCLLHSRVELAQEVSRRLVEVDPDNSAGYVMLANAFASQNQWSDVSELRLEM 573 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAG 260 KEKG+KK G+SWI ++G VHEFL G Sbjct: 574 KEKGIKKQPGSSWIVVDGVVHEFLIG 599 >XP_012575253.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820 [Cicer arietinum] Length = 639 Score = 121 bits (303), Expect = 3e-30 Identities = 52/86 (60%), Positives = 68/86 (79%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG+LL GC+LH ++E + +SK L++ DP NSAGYV+L+NA ASD +W DVS LR M Sbjct: 521 FVWGALLGGCLLHSRVELAQEVSKRLVQIDPNNSAGYVMLANALASDSQWSDVSALRLEM 580 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAG 260 +EKG+KK G+SWIS++G VHEFL G Sbjct: 581 REKGIKKQPGSSWISVDGVVHEFLVG 606 >XP_008455017.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like isoform X2 [Cucumis melo] Length = 468 Score = 119 bits (299), Expect = 4e-30 Identities = 53/87 (60%), Positives = 66/87 (75%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVW SLL GC+LH E + +SK L+ DPENSAGYV+ +N++ASDR+W DVS LR FM Sbjct: 357 FVWSSLLRGCLLHSSFELAQYVSKKLVEVDPENSAGYVMQANSFASDRQWDDVSALRWFM 416 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAGS 263 +EKGV K G SWISI+GTVHEF + + Sbjct: 417 REKGVHKQPGQSWISIDGTVHEFFSAT 443 >XP_007143083.1 hypothetical protein PHAVU_007G042100g [Phaseolus vulgaris] ESW15077.1 hypothetical protein PHAVU_007G042100g [Phaseolus vulgaris] Length = 632 Score = 120 bits (302), Expect = 4e-30 Identities = 51/86 (59%), Positives = 68/86 (79%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG+LL GC+LH ++E + +S+ L+ DP+NSAGYV+L+NA AS+ +W DVSELR M Sbjct: 514 FVWGALLGGCLLHSRVELAQEVSRRLVEVDPDNSAGYVMLANALASENQWSDVSELRLEM 573 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAG 260 KEKG+KK G+SWI ++G VHEFL G Sbjct: 574 KEKGIKKQPGSSWIVVDGVVHEFLVG 599 >XP_011088184.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Sesamum indicum] Length = 641 Score = 120 bits (302), Expect = 5e-30 Identities = 55/87 (63%), Positives = 69/87 (79%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWGSLL+GCVLH ++E + IS ML+R DPENS GYV+LSN++A+D +W DV +LR M Sbjct: 530 FVWGSLLSGCVLHNRIELAQVISTMLVRVDPENSGGYVMLSNSFAADCQWRDVLKLRRVM 589 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAGS 263 +EKGV K G SWI+I G VHEF+AGS Sbjct: 590 REKGVSKQPGRSWINIGGVVHEFVAGS 616 >EYU37608.1 hypothetical protein MIMGU_mgv1a006142mg [Erythranthe guttata] Length = 455 Score = 119 bits (298), Expect = 5e-30 Identities = 55/87 (63%), Positives = 66/87 (75%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG++LAG VLH +LE N+S ML+ DPENS GYV+LSN++ASD W VS+LR M Sbjct: 344 FVWGAILAGSVLHNRLEIARNVSSMLVGVDPENSGGYVMLSNSFASDLEWRSVSKLRVVM 403 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAGS 263 +EKGV K G SWI+I G VHEFLAGS Sbjct: 404 REKGVVKERGRSWITIGGVVHEFLAGS 430 >XP_004309732.2 PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] XP_011471026.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] XP_011471027.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 611 Score = 120 bits (301), Expect = 6e-30 Identities = 53/85 (62%), Positives = 67/85 (78%) Frame = +3 Query: 6 VWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFMK 185 VWG+LL GC+LH +L+ E +S L+++DP+N+ GYV+L+NA+ASD RWGDVS LR FM+ Sbjct: 499 VWGALLGGCLLHSRLDLAEYVSDKLVQSDPDNTGGYVMLANAFASDHRWGDVSSLRRFMR 558 Query: 186 EKGVKKHSGNSWISIEGTVHEFLAG 260 EKGV K G SWISI G VHEFL G Sbjct: 559 EKGVTKKPGCSWISINGVVHEFLVG 583 >XP_016489387.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Nicotiana tabacum] XP_016489388.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Nicotiana tabacum] Length = 614 Score = 120 bits (301), Expect = 6e-30 Identities = 56/87 (64%), Positives = 66/87 (75%) Frame = +3 Query: 3 FVWGSLLAGCVLHKKLEYGENISKMLIRADPENSAGYVLLSNAYASDRRWGDVSELRCFM 182 FVWG+LL GC+LH +LE + IS +L+ DP NSAGYV+LSN YASD+RW +S LR M Sbjct: 503 FVWGALLGGCMLHNRLELAQIISSILVEMDPNNSAGYVMLSNTYASDQRWSAISRLRLSM 562 Query: 183 KEKGVKKHSGNSWISIEGTVHEFLAGS 263 KEKGV K G SWI+I G VHEFLAGS Sbjct: 563 KEKGVAKMPGCSWINIAGVVHEFLAGS 589