BLASTX nr result
ID: Angelica27_contig00039323
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00039323 (382 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017250060.1 PREDICTED: SPX domain-containing protein 1 [Daucu... 67 1e-10 XP_017244128.1 PREDICTED: SPX domain-containing protein 1-like [... 65 4e-10 XP_010101877.1 hypothetical protein L484_015467 [Morus notabilis... 54 4e-06 XP_002524498.1 PREDICTED: SPX domain-containing protein 1 [Ricin... 54 8e-06 >XP_017250060.1 PREDICTED: SPX domain-containing protein 1 [Daucus carota subsp. sativus] KZM94569.1 hypothetical protein DCAR_017812 [Daucus carota subsp. sativus] Length = 280 Score = 67.0 bits (162), Expect = 1e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 280 IEDLRDRVASAEDWSEEMTDIRKEIVDFHGEMVL 381 ++DLRDRVASAEDWSEEM DIRKEIVDFHGEMVL Sbjct: 92 LKDLRDRVASAEDWSEEMIDIRKEIVDFHGEMVL 125 >XP_017244128.1 PREDICTED: SPX domain-containing protein 1-like [Daucus carota subsp. sativus] KZM97754.1 hypothetical protein DCAR_014884 [Daucus carota subsp. sativus] Length = 281 Score = 65.5 bits (158), Expect = 4e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 280 IEDLRDRVASAEDWSEEMTDIRKEIVDFHGEMVL 381 ++DLRDRVASA+DWSEEM DIRKEIVDFHGEMVL Sbjct: 93 LKDLRDRVASAKDWSEEMIDIRKEIVDFHGEMVL 126 >XP_010101877.1 hypothetical protein L484_015467 [Morus notabilis] EXB90173.1 hypothetical protein L484_015467 [Morus notabilis] Length = 297 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 280 IEDLRDRVASAEDWSEEMTDIRKEIVDFHGEMVL 381 +++L+DRVA A+D+SEEM IRKEIVDFHGEMVL Sbjct: 102 LKELQDRVAKAKDYSEEMFKIRKEIVDFHGEMVL 135 >XP_002524498.1 PREDICTED: SPX domain-containing protein 1 [Ricinus communis] EEF37938.1 xenotropic and polytropic murine leukemia virus receptor ids-4, putative [Ricinus communis] Length = 286 Score = 53.5 bits (127), Expect = 8e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +1 Query: 280 IEDLRDRVASAEDWSEEMTDIRKEIVDFHGEMVL 381 +++L+DRVA A+D++EEM IRKEIVDFHGEMVL Sbjct: 95 LKELQDRVAKAKDYNEEMIKIRKEIVDFHGEMVL 128