BLASTX nr result
ID: Angelica27_contig00039238
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00039238 (234 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN04836.1 hypothetical protein DCAR_005673 [Daucus carota subsp... 52 5e-06 XP_017233928.1 PREDICTED: transcription factor TCP9-like [Daucus... 52 7e-06 >KZN04836.1 hypothetical protein DCAR_005673 [Daucus carota subsp. sativus] Length = 202 Score = 51.6 bits (122), Expect = 5e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -3 Query: 112 AFHDDEGGVSDISTSGGENESGRPVFKNEE 23 AF +DEGG SDISTS GENE GRPVFK E+ Sbjct: 2 AFQEDEGGASDISTSDGENEPGRPVFKEED 31 >XP_017233928.1 PREDICTED: transcription factor TCP9-like [Daucus carota subsp. sativus] Length = 254 Score = 51.6 bits (122), Expect = 7e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -3 Query: 112 AFHDDEGGVSDISTSGGENESGRPVFKNEE 23 AF +DEGG SDISTS GENE GRPVFK E+ Sbjct: 2 AFQEDEGGASDISTSDGENEPGRPVFKEED 31