BLASTX nr result
ID: Angelica27_contig00039234
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00039234 (275 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017241772.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 8e-17 >XP_017241772.1 PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Daucus carota subsp. sativus] KZN01203.1 hypothetical protein DCAR_009957 [Daucus carota subsp. sativus] Length = 882 Score = 83.6 bits (205), Expect = 8e-17 Identities = 44/62 (70%), Positives = 47/62 (75%), Gaps = 3/62 (4%) Frame = +1 Query: 97 MQTLPLPFKSTPIHKHDALSEFPLKPNKHTVSYSNNP---TLTDAHLNNLCSNGRLKEAI 267 MQTL LP KST I K+D SEFPLKPNK+TVS+SN P TDAHL NLCSNGRL EAI Sbjct: 1 MQTLTLPIKSTAIPKNDTFSEFPLKPNKNTVSFSNAPNSVASTDAHLINLCSNGRLSEAI 60 Query: 268 DA 273 A Sbjct: 61 HA 62