BLASTX nr result
ID: Angelica27_contig00038965
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00038965 (258 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017219871.1 PREDICTED: pentatricopeptide repeat-containing pr... 109 6e-26 >XP_017219871.1 PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Daucus carota subsp. sativus] XP_017219872.1 PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Daucus carota subsp. sativus] XP_017219873.1 PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Daucus carota subsp. sativus] KZM88138.1 hypothetical protein DCAR_025213 [Daucus carota subsp. sativus] Length = 744 Score = 109 bits (272), Expect = 6e-26 Identities = 58/86 (67%), Positives = 64/86 (74%) Frame = -1 Query: 258 PTNQPHXXXXXXXXXXXXXXSITRQLGSTGAALKFLTFLRSQSPDPLSVSLTFQALLELA 79 P N PH S+TRQLGSTGAALKFLTFLR+ SPDP S+SLTFQALLELA Sbjct: 54 PINTPHLLSLLPSLSPPCYLSLTRQLGSTGAALKFLTFLRAHSPDPPSISLTFQALLELA 113 Query: 78 SHSCSLRLSQSDIVQELKELFKLCRE 1 +HS S RL QSDI ++LKELFKLCRE Sbjct: 114 THSGSSRLPQSDIAEKLKELFKLCRE 139