BLASTX nr result
ID: Angelica27_contig00038951
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00038951 (286 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017238455.1 PREDICTED: fatty acid amide hydrolase-like isofor... 60 2e-08 XP_017238456.1 PREDICTED: fatty acid amide hydrolase-like isofor... 58 1e-07 KZN00860.1 hypothetical protein DCAR_009614 [Daucus carota subsp... 58 1e-07 KZM92675.1 hypothetical protein DCAR_019960 [Daucus carota subsp... 55 1e-06 XP_017256791.1 PREDICTED: fatty acid amide hydrolase-like [Daucu... 55 1e-06 >XP_017238455.1 PREDICTED: fatty acid amide hydrolase-like isoform X1 [Daucus carota subsp. sativus] Length = 662 Score = 59.7 bits (143), Expect = 2e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 181 RMGITKRVVYKPADQVDVSSTSDELYIRANVKAPR 285 RM ++KRVVYKPADQVDVS TSDE+Y+ ANVKAPR Sbjct: 48 RMVMSKRVVYKPADQVDVSFTSDEVYVEANVKAPR 82 >XP_017238456.1 PREDICTED: fatty acid amide hydrolase-like isoform X2 [Daucus carota subsp. sativus] Length = 614 Score = 57.8 bits (138), Expect = 1e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 184 MGITKRVVYKPADQVDVSSTSDELYIRANVKAPR 285 M ++KRVVYKPADQVDVS TSDE+Y+ ANVKAPR Sbjct: 1 MVMSKRVVYKPADQVDVSFTSDEVYVEANVKAPR 34 >KZN00860.1 hypothetical protein DCAR_009614 [Daucus carota subsp. sativus] Length = 685 Score = 57.8 bits (138), Expect = 1e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 184 MGITKRVVYKPADQVDVSSTSDELYIRANVKAPR 285 M ++KRVVYKPADQVDVS TSDE+Y+ ANVKAPR Sbjct: 1 MVMSKRVVYKPADQVDVSFTSDEVYVEANVKAPR 34 >KZM92675.1 hypothetical protein DCAR_019960 [Daucus carota subsp. sativus] Length = 600 Score = 55.1 bits (131), Expect = 1e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 184 MGITKRVVYKPADQVDVSSTSDELYIRANVKAPR 285 MG KRVVYKP +VDVSS+SDE+YI ANVKAPR Sbjct: 1 MGFCKRVVYKPVAEVDVSSSSDEVYISANVKAPR 34 >XP_017256791.1 PREDICTED: fatty acid amide hydrolase-like [Daucus carota subsp. sativus] Length = 617 Score = 55.1 bits (131), Expect = 1e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 184 MGITKRVVYKPADQVDVSSTSDELYIRANVKAPR 285 MG KRVVYKP +VDVSS+SDE+YI ANVKAPR Sbjct: 1 MGFCKRVVYKPVAEVDVSSSSDEVYISANVKAPR 34