BLASTX nr result
ID: Angelica27_contig00038875
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00038875 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY38955.1 hypothetical protein MANES_10G056000 [Manihot esculenta] 54 4e-06 >OAY38955.1 hypothetical protein MANES_10G056000 [Manihot esculenta] Length = 466 Score = 53.5 bits (127), Expect = 4e-06 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 6/93 (6%) Frame = -2 Query: 270 GGEKGLFGMV------LCKDFVSMTTVMGVSGFNKFPVYECDFGWGMPVRLEVSDMNEVG 109 G +KGLF L ++ V+G++G +F VYECDFGWG P ++E+ +++ G Sbjct: 367 GLKKGLFQRAADMAPRLKNAIITGAQVIGLAGSTRFDVYECDFGWGRPKKVEIISIDKTG 426 Query: 108 SIFLAPSPPPNHQNDVHITTLLPEDESRSLVAI 10 +I L S N + I L +DE + ++ Sbjct: 427 AISLTQSRDGN--GGIQIGLALSKDEMEAFASL 457